Recombinant Mouse Nucleophosmin (Npm1)

In Stock
Code CSB-EP737048MO
Abbreviation Recombinant Mouse Npm1 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Npm1; Nucleophosmin; NPM; Nucleolar phosphoprotein B23; Nucleolar protein NO38; Numatrin
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-292aa
Target Protein Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.6kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in diverse cellular processes such as ribosome biogenesis, centrosome duplication, protein chaperoning, histone assembly, cell proliferation, and regulation of tumor suppressors p53/TP53 and ARF. Binds ribosome presumably to drive ribosome nuclear export. Associated with nucleolar ribonucleoprotein structures and bind single-stranded nucleic acids. Acts as a chaperonin for the core histones H3, H2B and H4. Stimulates APEX1 endonuclease activity on apurinic/apyrimidinic (AP) double-stranded DNA but inhibits APEX1 endonuclease activity on AP single-stranded RNA. May exert a control of APEX1 endonuclease activity within nucleoli devoted to repair AP on rDNA and the removal of oxidized rRNA molecules. In concert with BRCA2, regulates centrosome duplication. Regulates centriole duplication: phosphorylation by PLK2 is able to trigger centriole replication. Negatively regulates the activation of EIF2AK2/PKR and suppresses apoptosis through inhibition of EIF2AK2/PKR autophosphorylation. Antagonizes the inhibitory effect of ATF5 on cell proliferation and relieves ATF5-induced G2/M blockade. In complex with MYC enhances the transcription of MYC target genes.
Gene References into Functions
  1. In the current study, we demonstrate the existence of a negative feedback loop through which an increased B23 expression suppresses ERalpha. Because suppression of ERalpha expression is a late event during estrogen-dependent endometrial tumorigenesis, the inhibition of nucleophisminmay represent a strategy to promote ERalpha re-expression that ultimately restores tumor sensitivity to hormonal therapy PMID: 27527851
  2. molecular complementarity underlies the higher frequency and significantly worse prognosis associated with NPM1c/FLT3-internal tandem duplications vs NPM1/NRAS-G12D-mutant acute myeloid leukemia (AML) and functionally confirm the role of HOXA genes in NPM1c-driven AML. PMID: 28835438
  3. NPM1 knockdown decreased NF-kappaB-mediated transcription of selected target genes by decreasing the recruitment of NF-kappaB p65 to the gene promoters. PMID: 28003476
  4. study suggests that although neurons need NPM1 for survival, an increase in its expression beyond physiological levels and its translocation to the cytoplasm leads to death through abortive cell cycle induction. PMID: 27510036
  5. The levels of B23 expression are directly regulated by EGR1. PMID: 26577150
  6. IDH2 and NPM1 mutations synergize in the development and maintenance of acute myeloid leukemia stem-like cells. PMID: 25795706
  7. a function of NPM1 in the spatial organization of nucleolus-associated heterochromatin through DNA methyltransferase DNMT3A PMID: 25349213
  8. The data presented here support a novel role for NPM1 as a multilevel modulator of the base excision repair pathway. PMID: 24648491
  9. The mechanism of G-CSF's neuroprotection may be related in part to attenuating neuronal apoptosis by NPM1. PMID: 24829950
  10. In conclusion, we successfully established xenotransplantation model of human FLT3-ITD (mut) /NPM1 (-) CN-AML in NOD/SCID mice. PMID: 23771655
  11. This in vivo model of Flt3/ITD+/NPMc+ leukemia closely recapitulates human disease and will therefore serve as a tool for the investigation of the biology of this common disease entity PMID: 24184354
  12. HOPS acts as a functional bridge in the interaction between NPM and p19(Arf) PMID: 22890319
  13. NPM-Bax interaction enhances mitochondrial Bax accumulation, organelle injury, and cell death. PMID: 23459946
  14. These results suggest that the down-regulation of the identified nucleophosmin proteins in QRsP-11 cells compared to QR-32 cells is possibly related to tumor malignant progression. PMID: 23267140
  15. Overexpression of Npm1 in mice results in myeloproliferation and implies a perturbation in hematopoietic microenvironment. PMID: 23226219
  16. The B23 regulates neuronal survival by preventing SIAH1-GAPDH death signaling under stress-induced conditions in the brain. PMID: 23027902
  17. the aberrant feed-forward pathway that keeps eIF4E and C/EBPalphap30 elevated in NPM1(+/-) cells contributes to the MDS phenotype associated with NPM1 deficiency. PMID: 22851180
  18. level of Npm1 expression has a role in regulating hematopoietic stem cell numbers in the bone marrow. PMID: 21979879
  19. A dual function of NPM1 in M-CSF-differentiated macrophages. PMID: 21876121
  20. propose that although the t(2;5) simultaneously reduces NPM1 allelic dosage and creates the NPM-ALK fusion protein, the two events do not cooperate in the pathogenesis of anaplastic large cell lymphoma in our mouse model PMID: 21709672
  21. The Tpt1-Npm1 complex as a novel marker for highly proliferating cells, and offer further insight into the network that controls cellular fate. PMID: 20505363
  22. Data show that Oct4, Sox2 and Nanog individually form complexes with nucleophosmin (Npm1) to control embryonic stem (ES) cell fate determination. PMID: 21076177
  23. the Cdk2/Cdk4/NPM pathway is a major guardian of centrosome dysfunction and genomic integrity. PMID: 19933848
  24. involvement of NPM/B23 in the acute response of mammalian cells to environmental stress, such as UV rays PMID: 12374805
  25. Involvement of CDK2/cyclin E and nucleophosmin/B23 in centrosome duplication PMID: 12429912
  26. overexpression in fused forme with ALK induced different types of malignant lymphomas in IL-9 transgenic mice PMID: 12555065
  27. identifed a multifunctional protein, B23 that strongly cross-reacts with a phospho-MEK antibody in mitotic cells; findings suggest a phsophorylation site on B23 may have a role in the regulation of mitotic B23 PMID: 15358159
  28. NPM in the nucleolus, ARF utilizes an additional mechanism of tumor suppression, one that is readily antagonized by Mdm2 PMID: 15485902
  29. essential developmental role for Npm, and implication of its functional loss in tumorigenesis and myelodysplastic syndrome pathogenesis PMID: 16007073
  30. Based on the sequence, bioinformatics analysis on genomic structure of nucleophosmin and the transcription factor binding sites in the NPM 5' flanking region were performed. PMID: 16018192
  31. NPM/B23 localizes between the paired centrioles of unduplicated centrosomes; inhibition of Crm1 nuclear export receptor results in both accumulation of cyclin E at centrosomes and efficient dissociation of NPM/B23 from centrosomes. PMID: 16297385
  32. B23 is a downstream effector of polyamines via phosphorylation by the protein kinase CK2 PMID: 16342411
  33. NPM plays an important role in hematopoiesis via mechanisms involving modulation of HSC/progenitor cell cycle progression and stress response PMID: 16608843
  34. The suppression of the proteolytic degradation of nucleophosmin was associated with LPS-induced RAW 264.7 murine macrophage cell activation. PMID: 16609939
  35. knock-down of Npm1 expression by this siRNA system was not only highly efficient, but also tetracycline- dose- and induction time-dependent. PMID: 16870143
  36. knockdown of NPM blocked the increases in Arf(-/-) ribosome output and osteoclast activity, demonstrating that these gains require NPM. PMID: 18070929
  37. a molecular mechanism of B23 in the mitotic inhibition of GCN5-mediated histone acetylation and transactivation. PMID: 18165222
  38. Npm1 acts as a haploinsufficient tumor suppressor in the hematopoietic compartment PMID: 18212245
  39. NPMc(+) acute myeloid leukemia represents a primary event rather than a transformation stage of NPMc(-) acute myeloid leukemia PMID: 18367491
  40. NPM-regulated ribosome export is a fundamental process in cell growth PMID: 18809582
  41. The p53-independent tumor suppressive functions of p19(Arf) may be mediated by its ability to antagonize Senp3, thereby inducing cell cycle arrest by abnormally elevating the cellular levels of SUMOylated proteins. PMID: 18948745
  42. NPM may protect cells from apoptosis by reducing the mitochondrial level of p53 PMID: 19366707
  43. Inhibiting Crm1 in early metaphase causes the formation of excess acentriolar spindle poles containing NuMA and B23, but does not affect centrosome numbers. PMID: 19522705
  44. Data demonstrate that the reduction in NPM protein expression blocks cellular growth and proliferation, whereas phosphorylation of NPM-Thr198 is not essential for NPM's capacity to drive cell cycle progression and proliferation. PMID: 19561638
  45. Npm1 may act as an alarmin: implications for sepsis are reported. PMID: 19581374

Show More

Hide All

Subcellular Location
Nucleus, nucleolus. Nucleus, nucleoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Protein Families
Nucleoplasmin family
Tissue Specificity
Expressed in B-cells that have been induced to switch to various Ig isotypes.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*