Recombinant Mouse Pro-neuropeptide Y (Npy), partial

In Stock Promotion
Code CSB-YP016034MO
Abbreviation Recombinant Mouse Npy protein, partial
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of Npy was greater than 90% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
≥ 90% as determined by SEC-HPLC.
Target Names
Uniprot No.
Research Area
Neuroscience
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
29-64aa
Target Protein Sequence
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.9 kDa
Protein Length
Partial
Tag Info
N-terminal hFc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Mouse Npy protein expression involves the transfection of Yeast cells with a DNA expression vector containing the gene encoding the protein of interest (29-64aa). Following transfection, the cells are cultured to induce the expression of the desired protein. The protein is equipped with a N-terminal hFc tag. The recombinant Mouse Npy protein is collected and purified from the cell lysate through affinity purification, achieving a purity greater than 85%, as determined by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
Gene References into Functions
  1. High NPY expression is associated with chronic social defeat stress. PMID: 30201296
  2. nalysis of hypothalamic and neuroendocrine responses to HFS throughout the light-dark cycle suggests uncoupling of hypothalamic responses involving appetite-stimulating fasting-responsive hypothalamic neurons expressing agouti-related peptide (AgRP) and neuropeptide Y (Npy). PMID: 28294152
  3. In this study we demonstrate dynamic changes in the number of calretinin- (CR) and neuropeptide Y-expressing (NPY) interneurons in the motor cortex of the familial hSOD1(G93A) ALS mouse model, suggesting their potential involvement in motor neuron circuitry defects. PMID: 28294153
  4. Study demonstrated that Skn-1a is only expressed when neuropeptide Y (NPY) is activated in microvillar cells (MVCs). Therefore the expression of NPY is necessary for the transcription factor-mediated differentiation of olfactory MVCs. PMID: 29530408
  5. Although acute loss of hypothalamic neurons that produce appetite-stimulating neuropeptide Y (Npy) and agouti-related peptide (Agrp) in adult mice or in mice homozygous for the anorexia (anx) mutation causes aphagia, our understanding of the factors that help maintain appetite regulatory circuitry is limited PMID: 28093506
  6. NPY knockout mice displayed altered behaviour as well as molecular and morphological changes in amygdala and hippocampus. NPY knockout mice responded to stress with exaggerated hyperthermia, displayed impaired spatial memory, had higher hippocampal brain-derived neurotrophic factor mRNA levels and altered hippocampal synaptic plasticity, effects which were not seen in wildtype mice. PMID: 27305846
  7. Orthopedic surgery modulates the expression of neuropeptide Y and BDNF at the spinal and hippocampal levels. PMID: 27791037
  8. salience of the background context memory is modulated through muscarinic activation of NPY(+) hilar perforant path associated interneurons and NPY signaling in the dentate gyrus PMID: 28775269
  9. NPY deficient mice had significantly impaired Hematopoietic stem/progenitor cell (HSPC) mobilization due to increased expression of HSPC maintenance factors by reduction of matrix metalloproteinase-9 (MMP-9) activity in bone marrow. PMID: 27090492
  10. These results identify SK3 as a key intrinsic mediator that coordinates nutritional status with AgRP/NPY neural activities and animals' feeding behavior and energy metabolism. PMID: 27829152
  11. The vasoconstrictive mechanism has been identified as neuropeptide Y acting on Y1 receptors. PMID: 27244241
  12. Findings suggest that neuropeptide Y is expressed by distinct populations of neurons can modulate afferent and efferent projections of the central amygdala via presynaptic Y2 receptors located at inhibitory and excitatory synapses. PMID: 26365505
  13. arcuate nucleus NPY neuropathway to the paraventricular nucleus and dorsomedial hypothalamus is pivotal in obesity-induced elevations in sympathetic nerve activity. PMID: 28628036
  14. NPY promotes airway hyperresponsiveness through the induction of Rho kinase activity and phosphorylation of myosin light chain, which induces airway smooth muscle contraction. PMID: 27088802
  15. stress alters CA1 circuit function through the impairment of endogenous NPY release, potentially contributing to heightened anxiety PMID: 28053027
  16. Npy expression is decreased in the cingulate cortex following chronic unpredictable stress. PMID: 27737789
  17. The results showed that NPY system activity is increased in a time- and space-dependent manner during bone repair. PMID: 27802308
  18. Decreased neuropeptide Y (NPY) expression in the extended amygdala might be causally linked with the depression induced following type 2 diabetes and that the antidepressant action of imipramine in diabetic mice might be mediated by NPY-NPY Y1 receptor system. PMID: 27208493
  19. lipolytic/thermogenic signaling, beta3-adrenergic receptor/hormone sensitive lipase, was markedly activated in white adipose tissue of NPY(-/-) mice compared with that of NPY(+/+) mice. PMID: 28101970
  20. These data establish the existence of a microRNA-mediated cross talk between enteric neurons producing NPY and intestinal epithelial cells, and the potential of neuropeptide-regulated miRNAs as potential therapeutic molecules for the management of inflammation-associated tumors in the gut. PMID: 27856419
  21. Stress may be associated with elevated peripheral neuropeptide Y level, which was observed to be associated with exacerbated airway inflammation in asthmatic mice. PMID: 26673939
  22. that preconditioning of mice with intermittent mild hypobaric hypoxia induces anxiolytic- and antidepressant-like effects which are accompanied by up-regulation of NPY which may suggest its mechanistic role PMID: 26994415
  23. confirms the critical role of Y2 signalling to control neuropeptide Y and associated pro-opiomelanocortin expression in the arcuate nuclei PMID: 26444586
  24. Neuropeptide Y (NPY) has been shown to be important in the modulation of anxiety. PMID: 26882036
  25. Diet composition, not calorie intake, rapidly alters intrinsic excitability of hypothalamic AgRP/NPY neurons in mice. PMID: 26592769
  26. NPY might be involved in the pathogenesis of METH-induced atherogenic effects through NPY Y1 receptor pathway in ApoE knockout mice PMID: 26409626
  27. NPY deficiency leads to reduced orexigenic stimulation and water diffusion parameters PMID: 25968479
  28. NPY suppresses cAMP activation of brown-like adipocytes via down-regulation o brown fat-relevant gene expression and mitochondrial function. PMID: 25451330
  29. Data show that chronic caloric restriction (CR) alters hypothalamic agouti-related protein (Agrp) and neuropeptide Y (Npy) gene expression similarly in Ghrelin+/+, Ghrelin-/-, ghrelin receptor Ghsr+/+, and Ghsr-/- mice. PMID: 26812158
  30. These data demonstrate a clear role for neuropeptide Y as a negative regulator of monocyte recruitment into the central nervous system and provide a new mechanism for suppression of retrovirus-induced neurological disease. PMID: 26719257
  31. NPY levels are decreased in Machado-Joseph disease (MJD) and that NPY overexpression is able to alleviate neuropathology and motor deficits in different MJD mouse models. PMID: 26220979
  32. Prader-Willi critical region deletion in mice containing Snord116, and specifically in NPY neurons, recapitulates the short stature and low bone mass density and aspects of the hormonal imbalance of Prader-Willi syndrome individuals. PMID: 26824232
  33. Npy gene expression in the arcuate nucleus is increased by intermittent fasting in diet-induced obese male mice. PMID: 26653760
  34. NPY expression is increased during atherogenesis and in particular in unstable plaques PMID: 24858338
  35. blocking the leptin-deficient increase in neuropeptide Y (NPY) expression reverses the cortical bone loss in ob/ob mice. PMID: 23044938
  36. reduction was observed in the neuropeptide Y (NPY)-positive subpopulation of GABAergic neurons in senescence-accelerated mouse prone 8 PMID: 26250996
  37. Results suggest that calorie restriction-induced changes in NPY are not directly involved in the suppression of lipopolysaccharide-induced microglial activation, however, NPY may indirectly affect microglial morphology through changes in body temperature PMID: 25446356
  38. NPY reduces neuronal firing in the nucleus accumbens resulting in increased palatable food intake PMID: 25109664
  39. Agrp-raptor KO mice displayed reduced, non-circadian expression of Agrp and NPY but normal feeding behavior and energy homeostasis on both normal and high fat diet PMID: 26159924
  40. Neuropeptide Y regulates the hematopoietic stem cell microenvironment and prevents nerve injury in the bone marrow. PMID: 25916827
  41. increase in pancreatic islet NPY level has little impact on islet function and is insufficient to affect glucose homeostasis PMID: 25285650
  42. Neuropeptide Y stimulates autophagy in hypothalamic neurons PMID: 25775546
  43. Following activation of PPARgamma, there was an increase in neuropeptide Y in the arcuate hypothalamus. PMID: 25788674
  44. NPY protects against excessive stress-induced bone loss. PMID: 24535841
  45. Results suggest that inhibition of NPY signaling in the brain by CCK-4 might be causal to anxiety- and depression-like behaviors PMID: 25106129
  46. NPY and PYY are required for CRF1 modulation of feeding behavior during stress. PMID: 25238483
  47. Study shows pronounced adaptive changes in the mouse hippocampus both with regard to NPY synthesis and NPY receptor synthesis and binding, which may contribute to regulating neuronal seizure susceptibility after kainate PMID: 24985894
  48. NPY and its Y receptor are possible mediators of both vasoconstriction and pulmonary vascular remodelling in pulmonary hypertension PMID: 24779394
  49. Deletion of NPY did not impact fed growth hormone release; however, it reversed the fasting-induced suppression of pulsatile GH secretion PMID: 25471570
  50. NPY deficiency reduces adiposity and ameliorates the age-related imbalance of adipose tissue metabolism, suggesting that antagonism of NPY may be a promising target for drug development to prevent age-related metabolic diseases PMID: 25205743

Show More

Hide All

Subcellular Location
Secreted. Cytoplasmic vesicle, secretory vesicle, neuronal dense core vesicle.
Protein Families
NPY family
Tissue Specificity
One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*