Recombinant Mouse Transcription factor AP-2-alpha (Tfap2a)

Code CSB-EP023414MO
Abbreviation Recombinant Mouse Tfap2a protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Tfap2a
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Tfap2a; Ap2tf; Tcfap2aTranscription factor AP-2-alpha; AP2-alpha; AP-2 transcription factor; Activating enhancer-binding protein 2-alpha; Activator protein 2; AP-2
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-437aa
Target Protein Sequence
MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALGSGLGDLPIHSLPHAIEDVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVARKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNSAKSSDKEEKHRK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2-alpha is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation. Associates with chromatin to the PITX2 P1 promoter region.
Gene References into Functions
  1. AP2gamma is present in a sub-population of hippocampal transient amplifying progenitors. There, it is found to act as a positive regulator of the cell fate determinants Tbr2 and NeuroD, promoting proliferation and differentiation of new glutamatergic granular neurons. Conditional ablation of AP2gamma in adult brain reduced hippocampal neurogenesis and disrupted coherence between ventral hippocampus and medial prefronta... PMID: 27777416
  2. these findings reveal that the AP-2 genes have a major function in mammalian neural crest development, influencing patterning of the craniofacial skeleton PMID: 29229773
  3. RNA interference of transcriptional factor activator protein 2alpha (AP-2alpha) reversed the inhibitory effects of aspirin on atherosclerosis in Apoe-/- mice. PMID: 27391154
  4. Study systematically examined the expression profile of AP-2 family in the developing mouse and chick spinal cord and found that AP-2alpha and AP-2beta are specifically expressed in post-mitotic dorsal interneurons. Subsequent functional assessment in chick embryos demonstrated that AP-2alpha and AP-2beta have distinct functions in dorsal interneuron specification and differentiation. PMID: 27984181
  5. MEX3C associates with the endolysosomal compartment through an endocytosis-like process. siRNA-mediated inhibition of the MEX3C or AP-2 complex substantially decreased exosomal but not cellular microRNA miR-451a expression PMID: 28982131
  6. High AP-2 alpha phosphorylation is associated with abdominal aortic aneurysm. PMID: 28179583
  7. overexpression of Dnmt3a partially rescued the impairment of adipogenesis induced by AP2alpha knockdown. PMID: 27906176
  8. Data show that TFAP2A binds many of the same regulatory elements as MITF in melanocytes. PMID: 28249010
  9. TFAP2A is a conserved component of the core network that regulates EMT, acting as a repressor of many genes, including ZEB2. PMID: 28412966
  10. The AP-2beta transcription factor is an important effector of PITX2 function during corneal development, required for differentiation of corneal endothelium and establishment of angiogenic privilege. PMID: 26968737
  11. the regulation of synaptic-vesicle (SV) recycling via early endosomes by the interdependent regulation of AP-2-mediated endocytosis and AP-1/sigma1B-mediated SV reformation, is reported. PMID: 25128028
  12. the Tfap2a and Tfap2b transcription factors were identified as two major downstream effectors of Ptf1a. PMID: 25966682
  13. Tfap2a-dependent changes in mouse facial morphology result in clefting that can be ameliorated by a reduction in Fgf8 gene dosage PMID: 25381013
  14. By gain-of function and loss-of-function approaches, ap2a and 2b were identified to be the major downstream targets of Ptf1a to specify the amacrine cell fate. PMID: 25966682
  15. results suggested that RNF20 may play roles in adipocyte differentiation by stimulating ubiquitin-proteasome-dependent degradation of AP-2alpha. PMID: 24374663
  16. N-terminal peptide sequencing indicates use of a downstream start codon in the human ortholog of AP-2. PMID: 3063603
  17. A conserved N-terminus is observed for alpha, beta, gamma, and epsilon members of this gene family. PMID: 14572467
  18. AP-2alpha defines epididymis-specific androgen receptor recruitment. It is constitutively bound to chromatin and guides AR to specific genomic loci upon hormone exposure. PMID: 24451200
  19. Nonsyndromic cleft palate in an animal model is associated with disruption of the Ap2beta1 gene. PMID: 20500056
  20. our data indicate that miR-17-92 modulates expression of critical T-box transcriptional regulators during midface development and is itself a target of Bmp-signaling and the craniofacial pioneer factor AP-2alpha PMID: 24068957
  21. critical roles for AP-2 activity in retinogenesis, delineating the overlapping expression patterns of Tcfap2a, Tcfap2b, and Tcfap2c in the neural retina, and revealing a redundant requirement for Tcfap2a and Tcfap2b in horizontal and amacrine cell development PMID: 22411557
  22. Tcfap2a is proposed as a candidate genetic regulator of the level of voluntary physical activity through its influence on a dopaminergic pathway. PMID: 21978078
  23. Whereas AP-2alpha/beta transcription factors are in vivo not required for the onset or maintenance of noradrenergic differentiation, their essential survival functions are demonstrated for sympathetic progenitors and noradrenergic neurons. PMID: 21539825
  24. AP-2alpha knockout mice exhibit optic cup patterning defects and failure of optic stalk morphogenesis. PMID: 20150232
  25. Expression of AP-2alpha transcription factors in breast cancer cells supports proliferation and contributes to chemo- and radiation-resistance of tumor cells by impairing the ability to induce apoptosis. PMID: 20459791
  26. downregulation of repressive isoforms during adipocyte differentiation PMID: 11688971
  27. Requirement for AP-2alpha in cardiac outflow tract morphogenesis. PMID: 11744375
  28. The results support a role of AP-2alpha in the etiology of exencephalic disorders PMID: 11967920
  29. ectopic expression in the lens disrupts fiber cell differentiation PMID: 11969252
  30. AP-2alpha modulates human corticotropin-releasing hormone gene expression in the placenta by direct protein-protein interaction. PMID: 12062896
  31. interactions among TFAP2A, CITED2, and p300/CBP are necessary for TFAP2A-mediated transcriptional activation and for normal neural tube and cardiac development. PMID: 12586840
  32. role for the AP-2 proteins in regulating the proliferation and differentiation of mammary gland epithelial cells PMID: 12654297
  33. AP-2alpha upregulation in both epithelial and mesenchymal hair follicle compartments was coordinated with initiation of major remodeling processes. PMID: 12839558
  34. provides evidence suggesting that AP-2alpha is a negative regulator of chondrocyte differentiation PMID: 14969394
  35. role in appropriate postnatal craniofacial morphogenesis PMID: 14975718
  36. AP-2alpha directs important aspects of neural crest cell function PMID: 14975722
  37. AP-2alpha is required for signaling from the surface ectoderm to the underlying mesoderm for proper development and closure of the ventral body wall. PMID: 15013802
  38. Missense mutation leads to misshapen middle ear bones. Homozygotes die perinatally, showing prominent abnormal facial structures PMID: 15181535
  39. Findings unveil a repressive role for AP-2alpha in governing EGFR gene transcription as epidermal cells exit the basal layer and withdraw from the cell cycle. PMID: 16449191
  40. Colocalization of Pax6 and AP-2alpha was mainly observed in the proliferating central lens epithelium, the same region in which the lens stalk phenotype was observed in the double heterozygous Pax6(+/lacZ)/AP-2alpha(+/-) eyes. PMID: 17679940
  41. These data demonstrate that, whereas AP-2alpha alone does not play an intrinsic role in retinogenesis, it has non-cell-autonomous effects on optic cup development. PMID: 17724084
  42. major role for this enhancer resides within the limb bud, and it serves to maintain a level of Tcfap2a expression that limits the size of the hand plate and the associated number of digit primordia PMID: 17984226
  43. findings presented in this study clearly demonstrate that AP-2 has cell-autonomous roles in lens vesicle separation and maintenance of the lens epithelial cell phenotype PMID: 18224708
  44. PKC beta II upregulates TTP expression in activated macrophages. This regulation is mediated through the activation of transcription factor AP-2, and serves as an additional mechanism how PKC beta regulates the inflammatory process. PMID: 18594783
  45. AP-2alpha and AP-2gamma, in concert with Notch, play an essential role in the terminal differentiation of the skin epidermis in mice. PMID: 18824566
  46. These findings place IRF6 and AP-2alpha in the same developmental pathway and identify a high-frequency variant in a regulatory element contributing substantially to a common, complex disorder. PMID: 18836445
  47. these studies support a tumor suppressor role for AP-2alpha in the gastrointestinal tract. PMID: 19376641
  48. AP-2alpha regulated gene Axl is an essential player in GN-11 neuron migration. PMID: 19463168

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
AP-2 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*