Recombinant Mouse Ubiquitin-protein ligase E3A(Ube3a),partial

Code CSB-YP025488MO
Size US$1916
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names Ube3a
Uniprot No. O08759
Research Area Epigenetics and Nuclear Signaling
Alternative Names Ube3a; Ubiquitin-protein ligase E3A; EC 2.3.2.26; HECT-type ubiquitin transferase E3A; Oncogenic protein-associated protein E6-AP
Species Mus musculus (Mouse)
Source Yeast
Expression Region 542-870aa
Target Protein Sequence NPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDEATKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGSVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRESVVIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 39.9kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and transfers it to its substrates. Several substrates have been identified including the RAD23A and RAD23B, MCM7 (which is involved in DNA replication), annexin A1, the PML tumor suppressor, and the cell cycle regulator CDKN1B. Additionally, may function as a cellular quality control ubiquitin ligase by helping the degradation of the cytoplasmic misfolded proteins. Finally, UBE3A also promotes its own degradation in vivo (By similarity). Plays an important role in the regulation of the circadian clock
Gene References into Functions
  1. Paternal UBE3A also partially colocalizes with a marker of neural progenitors, SOX2, implying that relaxed or incomplete imprinting of paternal Ube3a reflects an overall immature molecular phenotype PMID: 27306933
  2. Using in vivo patch-clamp electrophysiology, study measured the visually evoked responses to square-wave drifting gratings in L2/3 regular-spiking (RS) neurons in control mice, Ube3a-deficient mice (Angelman syndrome model), and mice in which Ube3a was conditionally reinstated in GABAergic neurons; found that Ube3a-deficient mice exhibited enhanced pyramidal neuron excitability in vivo as well as weaker orientation tuning PMID: 28468997
  3. Findings show neuronal overexpression of Ube3a isoform 2 causes phenotypes translatable to neurodevelopmental disorders. PMID: 29016856
  4. Findings suggest that aberrant function of Ube3a could influence the progression of AD and restoring normal level of Ube3a might be beneficial for AD. PMID: 29016862
  5. Encephalomyocarditis virus (EMCV) 3C protease accumulates to higher levels in EMCV-infected E6AP knockdown cells than in control cells, indicating a role for E6AP in in vivo 3C protease concentration regulation. PMID: 29054411
  6. The expression of three tumor suppressor genes encoded in the INK4/ARF locus (p15(INK4b), p16(INK4a), and p19(ARF)) was decreased in E6AP(-/-) embryo fibroblasts. PMID: 28074012
  7. Maternal loss of Ube3a affects nociception via a central, but not peripheral mechanism. PMID: 28931574
  8. Our findings suggest that UBE3A may act locally to regulate individual synapses while also mediating global, neuronwide influences through the regulation of gene transcription PMID: 27339004
  9. We report that mice with maternally-inherited deletions of Ube3a that models Angelman syndrome show an increased social preference/interaction. PMID: 28411125
  10. increasing UBE3A in the nucleus downregulates the glutamatergic synapse organizer Cbln1, which is needed for sociability in mice PMID: 28297715
  11. Based on our findings, we propose that imprinting of UBE3A does not function to reduce the dosage of UBE3A in neurons but rather to regulate some other, as yet unknown, aspect of gene expression or protein function PMID: 28515788
  12. the role of UBE3A is investigated in neurite contact guidance during neuronal development, is reported. PMID: 26845073
  13. Results substantiate GABAergic Ube3a loss as the principal cause of circuit hyperexcitability in Angelman syndrome mice, lending insight into ictogenic mechanisms in AS. PMID: 27021170
  14. Loss of Ube3a from tyrosine hydroxylase-expressing neurons impairs mesoaccumbal, non-canonical GABA co-release and enhances reward-seeking behaviour measured by optical self-stimulation. PMID: 26869263
  15. Results suggest that the phenotypes observed in Angelman syndrome mice may be modulated by factors independent of Ube3a genotype PMID: 26028516
  16. UBE3A dampens ERK pathway signalling in HPV E6 transformed HeLa cells PMID: 25815718
  17. The normal window of development in Angelman syndrome patients is supported by an incompletely silenced paternal allele in developing neurons, resulting in a relative preservation of Ube3a expression during this crucial epoch of early development. PMID: 25894543
  18. Inactivation of Ube3a expression elevates BMAL1 levels in brain regions that control circadian behavior of AS-model mice, indicating an important role for Ube3a in modulating BMAL1 turnover. PMID: 25660546
  19. This study demonstrated that abnormal sleep patterns arise from a deficit in accumulation of sleep drive, uncovering the Ube3a gene as a novel genetic regulator of sleep homeostasis PMID: 26446213
  20. The deficiency of Ube3a in Huntington's disease (HD) mice brain also caused significant increase in global aggregates load, and these aggregates were less ubiquitinated when compared with age-matched HD mice. PMID: 25027318
  21. There are distinct neurodevelopmental windows when Ube3a restoration rescues Angelman-syndrome-like phenotypes. Motor deficits are rescued in adolescence. Anxiety, repetitive behavior, and epilepsy are rescued in early development. PMID: 25866966
  22. Mature oligodendrocytes express Ube3a in the cortex and white matter tracts during development. PMID: 24254964
  23. findings provide novel insight into the regulation of Ube3a by synaptic activity and its potential role in kinase regulation PMID: 24434871
  24. These studies demonstrate the feasibility and utility of unsilencing the paternal copy of Ube3a via targeting Ube3a-ATS as a treatment for Angelman syndrome. PMID: 24385930
  25. Activating UBE3A disrupts circadian oscillations in mouse embryonic fibroblasts and rhythms in endogenous mRNA and protein levels of BMAL1. PMID: 24728990
  26. Aging-dependent Ube3a levels result in differential ubiquitination and degradation of Htt fragments, thereby contributing to the age-related neurotoxicity of mutant Htt. PMID: 24706802
  27. This study demonistrated that Changes in mGlu5 receptor-dependent synaptic plasticity and coupling to homer proteins in the hippocampus of Ube3A hemizygous mice. PMID: 24672001
  28. These results demonstrate that UBE3A plays a role in MC1R transcriptional regulation. PMID: 21733131
  29. E6AP may negatively control adipogenesis by inhibiting C/EBPalpha expression. PMID: 23762344
  30. MeCP2 and E6AP play a role in the transcriptional control of common target gene expression. PMID: 23791832
  31. This study described a novel phenotype of severely distended Golgi cisternae in the Angelman syndrome model mouse. PMID: 23447592
  32. The present study is the first to determine that the Ube3a protein ablation seen in the Angelman syndrome mouse model is also characteristic of Angelman syndrome patients PMID: 22560727
  33. findings showed that Ube3a-ATS is an atypical RNAPII transcript that functions to suppress paternal Ube3a expression PMID: 22493002
  34. the loss of function of Ube3a might be associated with the synaptic abnormalities observed in HD. PMID: 22787151
  35. study reports that Ube3a regulates glucocorticoid receptor (GR) transactivation; the GR signaling pathway is disrupted in Ube3a-maternal-deficient mice brain that eventually leads to increased susceptibility to stress and anxiety in these Angelman syndrome mice PMID: 22215440
  36. This study demonistrated that Ube3a deficices mice product produces an excitatory/inhibitory imbalance through neuron type-specific synaptic in visual cortex. PMID: 22681684
  37. our study implicates E6AP as an important regulator of the cellular response to stress, in particular through the regulation of replicative and oncogene-induced senescence. PMID: 21927031
  38. The results suggest that Ube3a gene dosage may contribute to the autism traits of individuals with maternal 15q11-13 duplication and support the idea that increased E3A ubiquitin ligase gene dosage results in reduced excitatory synaptic transmission. PMID: 21974935
  39. In a mouse model of Angelman syndrome, since hippocampal and Purkinje cells have the highest expression of UBE3A in a mouse model of Angelman syndrome, these cells would have the greatest sensitivity to the UBE3A m-\p+ maternal\paternal genotype. PMID: 19563863
  40. HERC2 acts as a regulator of E6AP. PMID: 21493713
  41. The levels of total Akt and phosphorylated Akt (active Akt) are increased in E6-AP overexpressing prostate gland and LNCaP cells suggesting that E6-AP regulates the PI3K-Akt signaling pathway. PMID: 20826237
  42. Data show RNA interference that targets Ube3a in P19 cells caused downregulation of Mc1r and Nr4a2, whereas overexpression of Ube3a results in the upregulation of Mc1r and Nr4a2. PMID: 20571502
  43. Ube3a exhibits brain cell type-specific imprinting, with monoallelic expression from the maternal allele in neurons, but biallelic expression in glial cells. The antisense Ube3a transcript is reciprocally imprinted only in neurons. PMID: 12668607
  44. Ube3a expression is primarily neuronal in all brain regions and present in GABAergic interneurons as well as principal neurons. PMID: 20423730
  45. E6-associated protein is required for human papillomavirus type 16 E6 to cause cervical cancer. PMID: 20530688
  46. polycomb protein Ring1B regulation by self-ubiquitination or by E6-AP may have implications to the pathogenesis of Angelman syndrome PMID: 20351251
  47. As demonstrated by optical imaging, rapid ocular dominance plasticity after brief monocular deprivation was severely impaired during the critical period in the visual cortex of Ube3a maternal-deficient (m-/p+) mice. PMID: 20212164
  48. Disruption of Ube3A function in neurons leads to an increase in Arc expression and a concomitant deregulation in AMPA receptors at synapses; which may contribute to the cognitive dysfunction that occurs in Angelman Syndrome. PMID: 20211139
  49. The imprinted Ube3a antisense transcript is regulated by the U exons rather than Snurf/Snrpn exon 1 (Ube3a antisense RNA). PMID: 15226413
  50. loss of E6AP catalytic activity and improper regulation of E6AP substrate are important in the development of Angelman syndrome PMID: 15263005
  51. Reduced expression of UBE3A is associated with autism PMID: 15615769
  52. E6AP ubiquitin ligase is required for transactivation of the hTERT promoter by the human papillomavirus E6 oncoprotein PMID: 15655249
  53. These data validate the mouse model produced by null mutation of the maternal Ube3a gene and provide useful results to investigate and better understand the molecular basis of sleep disturbances in AS patients. PMID: 15921919
  54. Maternal transmission of Ube3a mutation leads to increased expression of the paternal Ube3a-non-coding antisense transcript. PMID: 16027444
  55. E6-AP deletion attenuates the growth and development of the prostate gland by interfering with androgen receptor function as well as by stimulating apoptosis. PMID: 16254014
  56. As Ube3a is only imprinted in brain, we evaluated Ube3a expression in brains of 15 different litters of neonatal or 8-week-old male Mecp2 mutant mice. PMID: 16754645
  57. proteolytic properties of human papillomavirus E6 proteins are mediated by interaction with E6-AP PMID: 17085449
  58. Analysis of Ube3a mRNA and protein levels in Mecp2(R168X) mutant male mice (a Rett syndrome model) showed no significant difference in expression compared to wild type littermates. PMID: 17936729
  59. in Ube3a maternal-deficient mice, dendritic spine development, including spine morphology, number and length, is affected on cerebellar Purkinje cells and on pyramidal neurons in the hippocampus and cortex PMID: 17940072
  60. The differences in behavioral measure of cerebellar function distinguish mice that are deficient for maternal-specific expression of Ube3a from mice with complete absence of Ube3a expression. PMID: 18413322
  61. We conclude that Ube3a is necessary for maintaining plasticity during experience-dependent neocortical development and suggest that the loss of neocortical plasticity contributes to deficits associated with Angelman syndrome. PMID: 19430469
  62. This study suggested that E6-AP not only enhances the degradation but also regulates the expression of p27 and its loss of function in Angelman syndrome might cause cell cycle alteration leading to disease pathogenesis. PMID: 19591933
  63. Ube3a deletion and may contribute to the hippocampal dysfunction observed in Angelman syndrome mice PMID: 19782683

Show More

Hide All

Subcellular Location Cytoplasm, Nucleus
Tissue Specificity Widely expressed. Most abundant in brain, heart and thymus.
Database Links

KEGG: mmu:22215

STRING: 10090.ENSMUSP00000103161

UniGene: Mm.9002

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1