Recombinant Synsepalum dulcificum Miraculin

In Stock
Code CSB-YP320179RES
Abbreviation Recombinant Synsepalum dulcificum Miraculin protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Uniprot No.
Research Area
others
Alternative Names
Miraculin; MIR
Species
Synsepalum dulcificum (Miracle fruit) (Richadella dulcifica)
Source
Yeast
Expression Region
30-220aa
Target Protein Sequence
DSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The generation of recombinant Synsepalum dulcificum Miraculin in yeast begins with co-cloning the target gene (30-220aa of Synsepalum dulcificum Miraculin) into an expression vector with an N-terminal 6xHis-tag gene and transforming it into yeast cells. The yeast cells are cultured under conditions that induce protein expression. After sufficient growth, the cells are lysed to release the recombinant protein. The recombinant Synsepalum dulcificum Miraculin is purified from the cell lysate through affinity chromatography. Its purity is assessed using SDS-PAGE, exceeding 85%.

Miraculin is a taste-modifying protein derived from the miracle fruit, Synsepalum dulcificum. This protein interacts with human sweet-taste receptors, causing sour flavors to be perceived as sweet [1][2][3]. The miracle fruit, known for its miraculous sweetening glycoprotein, miraculin, has the unique ability to alter sour tastes into sweet ones when consumed [4][5][2]. This taste-altering effect has been studied extensively, showing that miraculin can temporarily and almost completely replace sour tastes with sweet ones [1]. The glycoprotein miraculin found in Synsepalum dulcificum has been shown to positively impact the palatability of various substances, making sour or bitter tastes more enjoyable by transforming them into sweet perceptions [5].

The glycoprotein miraculin in Synsepalum dulcificum has been of interest not only for its taste-modifying properties but also for its potential nutritional benefits and medicinal uses [3]. Studies have highlighted the unique taste-modifying property of the fruit due to the presence of miraculin, making it a peculiar medicinal plant with significant potential [3]. Additionally, research has shown that miraculin from Synsepalum dulcificum can induce differential sweetness in various sour liquids, further emphasizing its role in taste perception [2].

References:
[1] A. Capitanio, G. Lucci, & L. Tommasi, Mixing taste illusions: the effect of miraculin on binary and trinary mixtures, Journal of Sensory Studies, vol. 26, no. 1, p. 54-61, 2011. https://doi.org/10.1111/j.1745-459x.2010.00321.x
[2] G. Igarashi, R. Higuchi, T. Yamazaki, N. Ito, I. Ashida, & Y. Miyaoka, Differential sweetness of commercial sour liquids elicited by miracle fruit in healthy young adults, Food Science and Technology International, vol. 19, no. 3, p. 243-249, 2013. https://doi.org/10.1177/1082013212443060
[3] A. Akinmoladun, A. Adetuyi, K. Komolafe, & O. Oguntibeju, Nutritional benefits, phytochemical constituents, ethnomedicinal uses and biological properties of miracle fruit plant (synsepalum dulcificum shumach. & thonn. daniell), Heliyon, vol. 6, no. 12, p. e05837, 2020. https://doi.org/10.1016/j.heliyon.2020.e05837
[4] Z. Yang, Z. Liu, H. Xu, Y. Chen, P. Du, P. Liet al., The chromosome-level genome of miracle fruit (synsepalum dulcificum) provides new insights into the evolution and function of miraculin, Frontiers in Plant Science, vol. 12, 2022. https://doi.org/10.3389/fpls.2021.804662
[5] L. López, M. Vela, I. Ibarra, L. Díaz, L. Belmont, & S. Guillén, Positive improvement in palatability of metabolic formula with the use of miraculin protein in patients with inborn errors of metabolism and healthy adults, Revista Chilena De Nutrición, vol. 47, no. 5, p. 801-807, 2020. https://doi.org/10.4067/s0717-75182020000500801

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I have some more questions:
- What is the host organism? Is the protein produced in bacteria, yeast or mammalian cell?
- Have you (or your customers) checked the in vivo activity of the protein (e.g. taste test or similar test with sweet taste receptor)?
-Does the protein change sour to sweet taste, as it is known for the berry extract?

A:
Thanks for your inquiry.
CSB-YP320179RES we haven't detect the activity of this protein. We express the mature full length protein, it have activity in theory, but we are not guarantee about it. We have check if there is a reference about the activity, but get nothing. We only found the reference about the nature protein. Pls refer to tohttps://www.ncbi.nlm.nih.gov/pubmed/3403544

Target Background

Function
Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes.
Protein Families
Protease inhibitor I3 (leguminous Kunitz-type inhibitor) family
Tissue Specificity
Expressed in fruit pulp after pollination. Not expressed in seeds, stems or leaves.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*