Recombinant Synsepalum dulcificum Miraculin

In Stock
Code CSB-EP320179RES
Abbreviation Recombinant Synsepalum dulcificum Miraculin protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Uniprot No.
Research Area
others
Alternative Names
Miraculin; MIR
Species
Synsepalum dulcificum (Miracle fruit) (Richadella dulcifica)
Source
E.coli
Expression Region
30-220aa
Target Protein Sequence
DSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CUSABIO transfected the expression vector which inserted the recombinant DNA into the E.coli, cultured the cells, and then induced the transcription and translation of the cloned vector. The N-terminal 10xHis tag sequence was appended to the gene coding for the E.coli of the Synsepalum dulcificum MIR protein to form the recombinant DNA. The recombinant Synsepalum dulcificum MIR was expressed as N-terminal 10xHis-tagged fusion. The purity of the protein is greater than 85% assayed by SDS-PAGE. It has an apparent molecular weight of approximately 30 kDa.

Miraculin is a glycoprotein with taste-modifying activity and is isolated from miracle fruit (Synsepalum dulcificum). The protein can modify human's taste and turn a sour taste to a sweet taste. Recombinant miraculin was expressed in transgenic tomato plants, and was properly processed. Miraculin accumulated in transgenic tomato plants to levels higher than those in transgenic lettuce plants. This property of miraculin is helpful for preventing lifestyle diseases in that it can be used as a low-calorie sweetener or as an additive for foods targeting diabetics, as it removes the need for sugar. The active principle of the berry is the protein miraculin, which by itself is not sweet. Unlike sweet proteins, it has the unusual property of being able to turn a sour taste into a sweet taste. Sour foods, such as lemons, limes and grapefruit, taste sweet when tasted together with this protein. Namely, Miraculin by itself is not sweet, but it is able to turn a sour taste into a sweet taste. This unique property has led to increasing interest in this protein.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes.
Protein Families
Protease inhibitor I3 (leguminous Kunitz-type inhibitor) family
Tissue Specificity
Expressed in fruit pulp after pollination. Not expressed in seeds, stems or leaves.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*