Recombinant Human Lactadherin (MFGE8)

In Stock
Code CSB-EP013752HU
Abbreviation Recombinant Human MFGE8 protein
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
BA46; Breast epithelial antigen BA46; EDIL1; HMFG; hP47; HsT19888; Lactadherin; Medin; MFG-E8; MFGE8; MFGM; MFGM_HUMAN; Milk fat globule EGF factor 8; Milk fat globule EGF factor 8 protein; Milk fat globule-EGF factor 8; O acetyl disialoganglioside synthase; OAcGD3S; SED1; SPAG10; Sperm associated antigen 10; Sperm surface protein hP47
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
24-387aa
Target Protein Sequence
LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
56.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Advance your cardiovascular research with our high-quality Recombinant Human MFGE8 protein. Lactadherin, also known as MFGE8, plays a vital role in various biological processes such as apoptotic cell clearance, regulation of inflammation, and vascular homeostasis. Its involvement in these processes makes MFGE8 an essential protein to study for understanding cardiovascular and inflammatory diseases.

Our Recombinant Human MFGE8 protein represents the full length of the mature protein (24-387 amino acids) and is expressed in E. coli, ensuring efficient and reliable production. The N-terminal 6xHis-SUMO-tag guarantees effective purification without compromising the protein's structure or function. With a purity of greater than 90% as determined by SDS-PAGE, our Recombinant Human MFGE8 protein provides the quality and consistency required for your cardiovascular research. Choose this exceptional protein to boost the success of your experiments and uncover new insights into cardiovascular biology.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Could you pls indicate to me the endotoxin level (LAL, EU per mg) of your products.

A:
Very nice to receive your inquiry. The product details are confirmed as below.
Code: CSB-EP013752HU
Name: Recombinant Human Lactadherin(MFGE8)
Expression Region: 24-387aa; Full Length of Mature Protein
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Sequence:

LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC


Product Type: In-stock Recombinant Protein
Stock Amount: Sufficient
Delivery Form: Liquid
Storage Buffer: 100 mM Tris-HCl, 0.4M Arg, pH 8.0, 50% glycerol
Endotoxin Level: <1.0 EU per 1μg of the protein by the LAL method (We will perform Endotoxin Removal upon your request.)
Q:

We are looking for sterile, no endotoxin Mfge8. Is this product available?

A:
Thanks for your inquiry.
If you request for Endotoxin Removal and Aseptic Processing, the lead time will be extended for 2-3 business days, so the total lead time will be 5-10 business days.
We could guarantee Endotoxin Level: <1.0 EU per 1μg of the protein by the LAL method.
We have tried several times to remove endotoxin from this protein but failed. If you want Endotoxin Removal and Aseptic Processing, we could try again, but the possibility of failure is great.
Would you please check what experiment you plan to perform? Could you accept if we finally fail to remove endotoxin from this protein?
Looking forward to your response. Have a nice day.
Q:

What is the endotoxin level of this lot? Do you product sterile MFGE8 (no endotoxin)?

A:
Thanks for your inquiry.
If you request for endotoxin removal and aseptic processing, the lead time will be extended for 2-3 business days.
We have tried several times to remove endotoxin from this protein but failed. If you want endotoxin removal and aseptic processing, we could try again, but the possibility of failure is great.
Would you please confirm what experiment you plan to perform. Could you accept if we finally fail to remove endotoxin from this protein?
Q:

Unfortunately, unless you can guarantee endotoxin removal we would not be able to accept the protein. We are looking for levels at zero but could accept <0.001 or in that region.

A:
Thanks for your response. As mentioned in the last email, we have tried several times to remove endotoxin from this protein but failed, so we can't guarantee. Sorry about this.

Target Background

Function
Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization. Contributes to phagocytic removal of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction.; Main constituent of aortic medial amyloid.
Gene References into Functions
  1. Esophageal cancer patients with high MFG-E8 expression had worse overall survival and relapse-free survival in the subgroup with preoperative chemotherapy. The abundant MFG-E8 expression in esophageal squamous cell carcinoma might have a negative influence on the long-term survival of patients after chemotherapy by affecting T-cell regulation in the tumor microenvironment. PMID: 30156356
  2. MFGE8 polymorphisms were not associated with MetS but were related to DBP, HDL-C level, and WC in Chinese adults. PMID: 30053459
  3. This study showed for the first time that MFG-E8 expression is impaired in the endometrium of patients with endometriosis and infertility during the window of implantation. PMID: 28967712
  4. Our findings suggest that both MFGE8 and TGFbeta1 are agerelated inflammatory factors and are related to the degree of Atherosclerosis (AS). In conclusion, both MFGE8 and TGFbeta1 may serve as potential markers of the severity of AS PMID: 29152651
  5. Elevated serum MFG-E8 levels may be associated with cerebrovascular diseases or neuropsychiatric systemic lupus erythematosus. PMID: 28266034
  6. Circulating MFG-E8 levels are dramatically elevated in pregnancy, and are significantly higher in gestational diabetes mellitus than in normal pregnancy. PMID: 28035763
  7. MFG-E8 could be a potential novel prognostic marker for colorectal cancer (CRC) and overexpression of MFG-E8 might be involved in lymph node metastasis and angiogenesis of CRC. PMID: 28923329
  8. MFG-E8 levels are elevated in T2D but suppressed by increased adipose tissues, thereby allowing inflammatory factors to rise to high levels. MFG-E8 may serve as a potential biomarker for obesity and T2D in the clinical setting PMID: 28067023
  9. These findings provide a better understanding of the molecular mechanism underlying colorectal cancer progression and suggest a predictive role for MFG-E8 in colorectal cancer metastasis and prognosis PMID: 28653875
  10. Levels of MFGE8 were reduced in cirrhotic liver tissue from patients compared with controls. PMID: 27956229
  11. an efficient purification method for production of non-aggregated, full-length MFG-E8. PMID: 27102803
  12. Reduced serum milk fat globule-epidermal growth factor 8 (MFG-E8) concentrations are associated with an increased risk of microvascular complications in patients with type 2 diabetes. PMID: 28089751
  13. MFG-E8 is a protective factor in the pathogenesis of rheumatoid arthritis and subsequent bone loss. PMID: 26391522
  14. After myocardial infarction, Mfge8 (and Mertk)-expressing macrophages synergistically engage the clearance of injured cardiomyocytes. PMID: 26819373
  15. Studied the therapeutic effect of rhMFG-E8 in mouse models of IBD. Treatment with rhMFG-E8 significantly attenuated colitis in both models in a dose-dependent way. PMID: 25751740
  16. MFG-E8 promotes cutaneous wound healing by enhancing angiogenesis. PMID: 24838098
  17. Lactadherin may decrease inflammation by inhibiting secretory phospholipase A2 activity on pre-apoptotic leukemia cells. PMID: 24194865
  18. promotes tumor progression in oral squamous cell carcinoma PMID: 25264705
  19. MFG-E8 had a negative association with hs-CRP and a positive association with LDL-c. The serum level of MFG-E8 was negatively associated with the severity of coronary artery stenosis and the risk of clinical events. PMID: 24561551
  20. medin adopts a predominantly beta-sheet conformation with some unstructured elements. PMID: 24602872
  21. MFG-E8 could be used as a biomarker for diagnosis and monitoring of disease activity in certain systemic lupus erythematosus patients PMID: 24554711
  22. Exogenously added MFG-E8 inhibits receptor activator NF-kappaB ligand-induced osteoclastogenesis of human osteoclast precursors. PMID: 24958900
  23. Our results strongly suggested that MFG-E8 is a promising biomarker for the diagnosis, prognosis, and therapy target of opisthorchiasis-associated cholangiocarcinoma PMID: 24122204
  24. Blockage of MFG-E8 in endometrial tumor cells diminishes trophoblaast cell attachment. PMID: 24424369
  25. TNF-alpha up-regulates endometrial epithelial cell migration and MFG-E8 production. PMID: 24262600
  26. MFG-E8-dependent promotion of apoptotic cell clearance is a novel anti-inflammatory facet of glucocorticoid treatment PMID: 23832117
  27. our data argue that MFGE8 is not likely involved in the phagocytic clearance of neuronal debris associated with nigrostriatal pathway injury. PMID: 23194669
  28. NMR solution structure of C2 domain of MFG-E8 and insights into its molecular recognition with phosphatidylserine PMID: 23262193
  29. Milk fat globule-epidermal growth factor 8 has proapoptotic activity, suggesting participation in endometrial remodeling via an epithelial-stromal cell paracrine effect. PMID: 22921913
  30. MFG-E8 expression in the endometrial epithelium as well as in chorionic villi suggests its possible role in endometrial reorganization during the receptive phase and in events related to normal pregnancy in mammals PMID: 22770563
  31. Decreased colonic MFGE8 expression in patients with ulcerative colitis may be associated with mucosal inflammatory activity and clinical disease activity through basal cell apoptosis and preventing tissue healing in the pathogenesis of ulcerative colitis PMID: 22204000
  32. a key role of MFG-E8 release from apoptotic endothelial cells in macrophage reprogramming PMID: 22558449
  33. The distribution of the SNP (rs4945 and rs1878326) of MFGE8 was analyzed in two groups of patients with "wet" age-related macular Degeneration and their age-matched controls. PMID: 22438901
  34. serum lactadherin is correlated with poor blood glucose control and diabetic vascular complications. PMID: 22018779
  35. We conclude that MFG-E8-dependent signaling stimulates cell proliferation and the acquisition of mesenchymal properties and contributes to mammary carcinoma development. PMID: 21841820
  36. in vitro studies showed that medin amyloid-like fibrils promote the aggregation of protein amyloid A into fibrils PMID: 22070546
  37. Prolactin has a modulatory role for as a stromal/epithelial paracrine factor controlling MFG-E8. This is the first report on MFG-E8 protein localization to the human endometrial epithelium and its up-regulation during the window of implantation. PMID: 21177637
  38. MFG-E8 is expressed in triple-negative breast cancers as a target gene of the p63 pathway, but may serve a suppressive function in ER(+) and erbB2(+) breast cancers. PMID: 21127199
  39. overexpression of MFGE8 during bladder tumor development, correlated with expression of genes involved in cell adhesion or migration and in immune responses. PMID: 20956946
  40. intronic mutation in the human MFG-E8 gene can lead to the development of SLE. PMID: 20213738
  41. SED1 is expressed on the surface of acrosome-intact human sperm and in the anterior caput of the human epididymis, similar to that seen in mouse PMID: 18990388
  42. Truncated fragment of medin, the hexapeptide, NFGSVQ can form typical amyloid fibrils. PMID: 15478463
  43. Might prove useful in the treatment of prolonged ischemia. PMID: 16115445
  44. Lactadherin) is expressed in normal and atherosclerotic human arteries. PMID: 17420351
  45. The trans-activator (TA) isoforms of p63 activate MFGE8 transcription though a p53/p63 motif at -370, which was confirmed by a chromatin immunoprecipitation experiment. PMID: 17637751
  46. Identification of the last 18-19 amino acid residues as constituting the amyloid-promoting region of medin. PMID: 17679143
  47. aggregated medin induced death of aortic smooth muscle cells in vitro. Cells incubated together with medin increased the production of matrix metalloproteinase-2, a protease that degrades elastin and collagen and subsequently weakens the vessel wall. PMID: 17906662
  48. analysis of membrane-interactive loops of Lact-C2 PMID: 18160406
  49. Some childhood-onset and adult SLE patients carried a significant level of MFG-E8 in their blood samples. PMID: 18303131
  50. Lactadherin promoted phagocytosis of phosphatidylserine-expressing RBCs by macrophages in a concentration-dependent manner. PMID: 18647368

Show More

Hide All

Subcellular Location
Membrane; Peripheral membrane protein. Secreted. Cytoplasmic vesicle, secretory vesicle, acrosome membrane; Peripheral membrane protein.
Tissue Specificity
Mammary epithelial cell surfaces and aortic media. Overexpressed in several carcinomas.
Database Links

HGNC: 7036

OMIM: 602281

KEGG: hsa:4240

STRING: 9606.ENSP00000268150

UniGene: Hs.3745

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*