Recombinant Bovine Mitochondrial import receptor subunit TOM22 homolog(TOMM22)

Code CSB-CF024048BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A6QPI6
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence MAAAAAGPGAPLSADELLPKGDAEKPEEELEEEDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
Source in vitro E.coli expression system
Gene Names TOMM22
Protein Names Recommended name: Mitochondrial import receptor subunit TOM22 homolog Alternative name(s): Translocase of outer membrane 22 kDa subunit homolog
Expression Region 1-140
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Central receptor component of the translocase of the outer membrane of mitochondria (TOM complex) responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with the peripheral receptor TOM20 functions as the transit peptide receptor and facilitates the movement of preproteins into the translocation pore.
Subcellular Location Mitochondrion outer membrane, Single-pass membrane protein
Protein Families Tom22 family
Database Links

KEGG: bta:510780

STRING: 9913.ENSBTAP00000013405

UniGene: Bt.23269

Related Products

TOMM22 Proteins

TOMM22 Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.