Recombinant Dehalococcoides ethenogenes Glycerol-3-phosphate acyltransferase 5(plsY5)

Code CSB-CF674686DAAI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q3Z643
Storage Buffer Tris-based buffer,50% glycerol
Species Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) (Dehalococcoides ethenogenes (strain 195))
Sequence MSLVFIIMAIAGYLVGAIPMAYLLSRWRRGIDIRRYGSGNVGASNVVKTAGKRLGLAVFI FDVSKGAVMILLSGALGLALWQQIVVGLFTIAGHNWPVFLRFNGGRGIATSLGVALVMAP VPALIALGTAIAFGLFKKMAPGVFLGVAALPFMSGYFHGFFGIREYQTISWGFIGIFLIM VTRRLMAPDNEYAHTVSKAELIFNRMFLDRDIRSRSVWINRNSAPAEESPNIL
Source in vitro E.coli expression system
Gene Names plsY5
Protein Names Recommended name: Glycerol-3-phosphate acyltransferase 5 Alternative name(s): Acyl-PO4 G3P acyltransferase 5 Acyl-phosphate--glycerol-3-phosphate acyltransferase 5 G3P acyltransferase 5 Short name= GPAT 5 EC= 2.3.1.n3 Lys
Expression Region 1-233
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as fatty acyl donor, but not acyl-CoA or acyl-ACP.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families PlsY family
Database Links

KEGG: det:DET1611

STRING: 243164.DET1611

Related Products

plsY5 Proteins

plsY5 Proteins for Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) (Dehalococcoides ethenogenes (strain 195))

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.