Recombinant Human Adiponectin receptor protein 1 (ADIPOR1), partial

In Stock
Code CSB-CF001367HU2
Abbreviation Recombinant Human ADIPOR1 protein, partial
MSDS
Size $878
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
ADIPOR1; PAQR1; TESBP1A; CGI-45; Adiponectin receptor protein 1; Progestin and adipoQ receptor family member 1; Progestin and adipoQ receptor family member I
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
89-375aa
Target Protein Sequence
EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.8 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-Flag-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism. Required for normal glucose and fat homeostasis and for maintaining a normal body weight. ADIPOQ-binding activates a signaling cascade that leads to increased AMPK activity, and ultimately to increased fatty acid oxidation, increased glucose uptake and decreased gluconeogenesis. Has high affinity for globular adiponectin and low affinity for full-length adiponectin.
Gene References into Functions
  1. Upregulation of ADIPOR1 and SPP1, among the adipokine gene family, in cancer tissue is associated with poor survival in CRC, suggesting a potential mechanism linking obesity and colorectal cancer. PMID: 29761507
  2. ADIPOR1 was consistently associated with diabetes and hypertriglyceridemia in an admixed Latin American population. PMID: 29145541
  3. miR-221 acts as a promoter of the EMT process in HCC cells by targeting AdipoR1 PMID: 28539268
  4. The pathways related to tumorigenicity and tumor progression, STAT2 and AdipoR1/AMPK/SIRT1 could be restrained by miR-3908. In conclusion, restoration of miR-3908 expression induced suppression of cancer progression and glioblastoma tumorigenicity. PMID: 28440504
  5. Review/Meta-analysis: genetic polymorphisms in leptin, adiponectin and their receptors affect the development and progression of prostate cancer. PMID: 27768592
  6. Renoprotection of adiponectin is associated with improvement of the endothelial dysfunction, reduction of oxidative stress, and upregulation of endothelial nitric oxide synthase expression through activation of adenosine 5'-monophosphate-activated protein kinase by AdipoR1 and activation of peroxisome proliferator-activated receptor (PPAR)-alpha signaling pathway by AdipoR2. [review] PMID: 28402446
  7. High ADIPOR1 expression is associated with breast cancer. PMID: 28327197
  8. revised ADIPOR1 crystal structure exhibiting a seven-transmembrane-domain architecture that is clearly distinct from that of ADIPOR2 PMID: 28329765
  9. TNF-alpha impairs adiponectin/AdipoR1 signaling, mitochondrial biogenesis, and myogenesis in primary human myotubes cultures obtained from heart failure patients. PMID: 26921438
  10. the knockdown phenotype was partially rescued by injecting wild-type, but not mutant, human ADIPOR1 mRNA. We conclude that ADIPOR1 is a novel adRP-causing gene and plays an important role in rod development and maintenance. PMID: 27655171
  11. Adiponectin stimulates cPLA2 and COX-2 expression via AdipoR1/2-dependent activation of PKC/NADPH oxidase/mitochondria resulting in ROS accumulation, p300 phosphorylation, and histone H4 acetylation. PMID: 27288489
  12. Decreased expression of ADIPOR1 is associated with polycystic ovary syndrome. PMID: 27075719
  13. sequence- and structure-based computational tools were employed in this study to functionally and structurally characterize the coding Nonsynonymous Single Nucleotide Polymorphisms of ADIPOR1 gene listed in the single nucleotide polymorphisms database. PMID: 27294143
  14. PCR results showed expression of adiponectin, AdipoR1, AdipoR2, follicle-stimulating hormone receptor (FSHR), and luteinizing hormone receptor (LHR) in granulosa cells (GCs). After controlling body mass index (BMI) values, qRT-PCR demonstrated a decreased expression of adiponectin system in GCs of polycystic ovary syndromepatients compared to those in controls PMID: 26631404
  15. ADPOR1 variants, rs3737884*G and rs7514221*C, may be shared risk factors associated with CAD, T2D, and T2D with CAD in a population of northeast China. PMID: 26741812
  16. Expression of AdipoR1 gene receptor was increased in endometriotic stromal cells. PMID: 26459399
  17. miR-323 may increase VEGF-A-mediated cancer vascularization in PC cells through AdipoR1 suppression. PMID: 26160610
  18. We did not find any significant associations with ADIPOR1 gene variants and fasting plasma triglycerides in HIV-infected patients. PMID: 26111083
  19. In conclusion, neutrophil AdipoRs (AdipoR1, AdipoR2) upregulation was associated with early stages of vascular injury, hypertension severity, and low serum levels of adiponectin PMID: 26146630
  20. The ADIPOR1 rs1342387(G/A) polymorphism, but not rs12733285(C/T) or rs7539542(C/G), may be associated with cancer risk, especially risk of colorectal cancer in Asians. PMID: 26047008
  21. Results demonstrate that the non-conserved N-terminal trunks dictate the cell-surface expression and temporal signaling profiles of AdipoR1 and AdipoR2. PMID: 25892445
  22. Decreased AdipoR1 mRNA levels and increased circulating adiponectin in advanced stages of coronary artery disease implies that CAD could be related to 'adiponectin resistance'. PMID: 25582653
  23. Data indicate the thermal stability of purified N-terminally truncated mutants of adiponectin receptors AdipoR1 and AdipoR2. PMID: 25575462
  24. The present data suggest that the disturbed interaction of adiponectin with AMPK is located downstream of the AdipoR1 receptor. PMID: 24104889
  25. we not only detected significant decreases in plasma adiponectin levels in prostate cancer patients, but also showed significant decreases in adiponectin receptor I (AdipoR1) levels in the resected prostate cancer specimen PMID: 25586350
  26. This study indicated that ApN may play a role in the progression of colorectal adenomatous polyps to carcinoma through actions on adipo-R1 and adipo-R2 receptors. PMID: 25640382
  27. crystal structures of the human adiponectin receptors AdipoR1 and AdipoR2 at 2.9 A and 2.4 A resolution, respectively PMID: 25855295
  28. down-regulation of adiponectin receptors (AdipoR1, R2, and T-cadherin) in osteoarthritic chondrocytes PMID: 24888493
  29. Data suggested that variant rs1342387 on ADIPOR1 may be a novel colorectal cancer susceptibility factor but not rs12733285 neither ADIPOQ variants rs266729, rs822395, rs2241766, and rs1501299. PMID: 25516230
  30. ADIPOR1 rs1342387 polymorphism is significantly associated with risk of colorectal cancer PMID: 25292021
  31. In conclusion, all these observations suggest that adiponectin influences bone metabolism decreasing the levels of bone formation. PMID: 24673523
  32. The improvement of insulin sensitivity by physical exercise is related to adiponectin and/or AdipoR1/R2 expression changes. PMID: 25126860
  33. uremia results in upregulation of AdipoR1 but adiponectin resistance at the post-receptor level. PMID: 25049200
  34. macrophage polarization is a key determinant regulating AdipoR expression and differential APN-mediated macrophage inflammatory responses PMID: 25392268
  35. In those with advanced stage gastric cancer, 7 of 39 had low Adipo-R1 expression (17.9%) and 16 had low Adipo-R2 expression (41%). PMID: 24969908
  36. Adiponectin Receptor 1 has a role in reversing imatinib resistance in K562 human chronic myeloid leukemia cells PMID: 25475722
  37. Low ADIPOR1 expression is associated with hepatocellular carcinoma. PMID: 24619866
  38. ADIPOR1 risk polymorphisms are a strong candidate for the "common soil" hypothesis and could partially contribute to disease susceptibility to T2D, CAD, and T2D with CAD in the Northern Han Chinese population PMID: 24967709
  39. AdipoR1 stimulates IL10 production by activating the AMPK and MAPKp38 pathways, whereas AdipoR2 modifies inflammatory processes by activating the COX-2 and PPARG pathways. PMID: 25261236
  40. SNP rs1539355 in the ADIPOR1 gene is associated with insulin resistance in Chinese PCOS patients. PMID: 24335000
  41. Genome-wide expression profiling identified the transcription of ADIPOR1, VAMP3 and C11ORF10 to be correlated with decreased ANRIL expression in a time-dependent manner. PMID: 23813974
  42. adiponectin receptors(AdipoR1 and -R2 ) are located, or re-located, in the plasma membrane with distribution in the cytoplasm when mononuclear cells are committed to differentiate to osteoclasts. PMID: 23971629
  43. established link between obesity and RCC can therefore be further explained by the adiponectin deficiency in obese individuals together with reduced AdipoR1 protein in RCC PMID: 24096711
  44. SNPs of both the adiponectin gene and its receptors AdipoR1 and AdipoR2 (including their haplotypes) appear as candidate genes and involved in the development of the state of insulin resistance. PMID: 23656997
  45. ADIPOR1 gene single nucleotide polymorphism (13423870) associated with the increased risk in cardiovascular diseases in patients with nonalcoholic fatty liver disease PMID: 23293232
  46. non-alcoholic fatty liver disease patients, who were carriers of G allele rs6666089 ADIPOR1 had higher levels of visceral, subcutaneous adipose tissue and their relation and percentage of liver fat in comparison with ADIPOR1 A allele carriers PMID: 23388528
  47. AdipoR1 and leptin receptor protein levels were significantly higher in Barrett's esophagus patients compared to controls and obese controls. PMID: 23756394
  48. these data suggest that AdipoR1 protein levels are regulated by so far uncharacterized class I PDZ proteins PMID: 23860432
  49. SNPs in ADIPOR1 were associated with weight gain in women diagnosed with breast cancer. PMID: 23922112
  50. Studies indicate that altered levels of adiponectin and leptin or their cognate receptors in cancers can ultimately lead to an imbalance in downstream molecular pathways. PMID: 23355630

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
ADIPOR family
Tissue Specificity
Widely expressed. Highly expressed in heart and skeletal muscle. Expressed at intermediate level in brain, spleen, kidney, liver, placenta, lung and peripheral blood leukocytes. Weakly expressed in colon, thymus and small intestine.
Database Links

HGNC: 24040

OMIM: 607945

KEGG: hsa:51094

STRING: 9606.ENSP00000341785

UniGene: Hs.5298

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*