Recombinant Human Atypical chemokine receptor 3(ACKR3)

Code CSB-CF006257HU
Size US$3484Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names ACKR3
Uniprot No. P25106
Research Area Signal Transduction
Alternative Names ACKR3; atypical chemokine receptor 3; C X C chemokine receptor type 7; C-X-C chemokine receptor type 7; Chemokine (C-X-C motif) receptor 7; Chemokine C X C motif receptor 7; Chemokine orphan receptor 1; CMKOR1; CXC R7; CXC-R7; CXCR 7; CXCR-7; CXCR7; CXCR7_HUMAN; G protein coupled receptor 159; G protein coupled receptor; G protein coupled receptor RDC1 homolog; G-protein coupled receptor 159; G-protein coupled receptor RDC1 homolog; GPCR RDC1; GPR159; GPRN1; RDC 1; RDC-1; RDC1
Species Homo sapiens (Human)
Source in vitro E.coli expression system
Expression Region 1-362aa
Target Protein Sequence MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 57.5kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines CXCL11 and CXCL12/SDF1. Chemokine binding does not activate G-protein-mediated signal transduction but instead induces beta-arrestin recruitment, leading to ligand internalization and activation of MAPK signaling pathway. Required for regulation of CXCR4 protein levels in migrating interneurons, thereby adapting their chemokine responsiveness. In glioma cells, transduces signals via MEK/ERK pathway, mediating resistance to apoptosis. Promotes cell growth and survival. Not involved in cell migration, adhesion or proliferation of normal hematopoietic progenitors but activated by CXCL11 in malignant hemapoietic cells, leading to phosphorylation of ERK1/2 (MAPK3/MAPK1) and enhanced cell adhesion and migration. Plays a regulatory role in CXCR4-mediated activation of cell surface integrins by CXCL12. Required for heart valve development. Acts as coreceptor with CXCR4 for a restricted number of HIV isolates.
Gene References into Functions
  1. this study shows an essential role of CXCR7, together with CXCR4, in the control of normal and malignant hematopoietic cell migration and homing induced by CXCL12. PMID: 29433559
  2. Expression of CXCR7 associates with increased survival in CXCR4+ but not in CXCR4- DLBCL patients. CXCR7 overexpression in vitro is able to diminish DLBCL cell survival and increase their sensitivity to antitumor drugs. PMID: 29920526
  3. Residues 2-6 of ACKR3 form an antiparallel beta-sheet with the beta1 strand (residues 25-29) of CXCL12. PMID: 28098154
  4. These findings suggest that the manipulation of miR-539-5p/CXCR7 levels may have important therapeutic implications in choroidal neovascularization-associated diseases PMID: 29146732
  5. CXCR7 is an oncogene in PCa that can promote aggressive progression of PCa through enhancing proliferation and migration of the tumor cells. PMID: 30047547
  6. Study shows that overexpression of CXCR7 in different cellular populations of endometriosis microenvironment may play a role in the pathogenesis and represent a novel target for treatment. PMID: 29587613
  7. CXCR7 silencing inhibits the migration and invasion of human tumor endothelial cells derived from hepatocellular carcinoma by suppressing STAT3. PMID: 29901083
  8. Hetero-oligomerization of a1B/D-adrenergic receptor with the chemokine (C-X-C motif) receptor 4:atypical chemokine receptor 3 heteromeric complex is required for a1B/Dadrenergic receptor function PMID: 28862946
  9. This work demonstrates distinct roles for the SDF-1/CXCR4 or CXCR7 network in human induced pluripotent stem cell-derived ventricular cardiomyocyte specification, maturation and function. PMID: 28711757
  10. A role for CXCR7 in bladder cancer [review] PMID: 29022185
  11. CXCR7-small hairpin RNA inhibits tumour invasion and metastasis. PMID: 28429395
  12. Chemokine receptor CXCR7 may involve in the clinical glioblastoma (GBM) progression, and CXCR7 could be a valuable prognostic marker in the treatment of GBM. PMID: 28759950
  13. Therefore, CXCR7 may be associated with peritoneal metastasis in gastric cancer. PMID: 27941339
  14. CXCL12-CXCR7 axis accelerates migration and invasion of pancreatic cancer cells through mTOR and Rho/ROCK pathways, and predicts poor prognosis of pancreatic cancer PMID: 27542220
  15. The CXCR7/CXCL12 axis is involved in lymph node and liver metastasis of gastric cancer. PMID: 28533662
  16. Among 479 individuals affected with clear cell renal cell carcinoma, only synonymous variants were found in COPS8 and one of the missense variants in ACKR3:c.892C>T, was observed in 4/479 individuals screened PMID: 28063109
  17. Results show that CXCR7 is highly expressed in metastatic lymph node (MNL) of non-small cell lung neoplasm (NSCLC) and is associated with poor prognosis. PMID: 29032612
  18. While the potencies of all proteins in ACKR3 Presto-Tango assays were comparable, the efficacy of CXCL12(3-68) to activate ACKR3 was significantly reduced PMID: 29125867
  19. CXCR7 mediates CD14(+)CD16(+) monocyte transmigration across the blood brain barrier, and is a potential therapeutic target for neuro AIDS. PMID: 28754798
  20. CXCR7 signaling could not be detected using impedance measurements. However, increasing levels of CXCR7 expression significantly reduced the CXCR4-mediated impedance readout, suggesting a regulatory role for CXCR7 on CXCR4-mediated signaling. PMID: 28945785
  21. CXCR7 expression in gastric cancer tissues was significantly higher than that in adjacent non-cancer tissues and associated with tumor size, TNM stage and lymph node metastasis. CXCR7 was identified as a novel promoter in gastric cancer initiation and progression. PMID: 28281844
  22. the data identified the pivotal role of the receptor CXCR7 in pulmonary inflammation with a predominant effect on the pulmonary epithelium and polymorphonuclear neutrophils PMID: 28188248
  23. SDF-1/CXCR7 plays a positive role in the proliferation and invasion of endometrial carcinoma cells. PMID: 28239742
  24. our study demonstrates that the upregulation of CXCR7 signaling contributes to increased vasculogenic capacity of EOCs from CAD patients, indicating that CXCR7 signaling may be a novel therapeutic vasculogenic target for CAD. PMID: 27612090
  25. CXCR7 expression in the tumor cells and stromal cells from the metastatic foci was significantly more common in the group of male patients treated with cytotoxic drugs according to the FOLFOX6 regimen PMID: 28295006
  26. hypoxia and CXCL12-CXCR7 axis appeared to be advantageous microenvironments to CD20(-) CD138(-) cells in lymphoplasmacytic lymphoma PMID: 26878134
  27. suppressing CXCR4 is not enough to impede osteosarcoma invasion in bone marrow microenvironment since CXCR7 is activated to sustain invasion. Therefore, inhibiting both CXCR4 and CXCR7 could be a promising strategy in controlling osteosarcoma invasion. PMID: 28468584
  28. This short review intends to provide a concise summary of current knowledge with regards to cell-specific functions of CXCL12 and its receptors CXCR4 and CXCR7 with potential implications for the initiation and progression of atherosclerosis. [review] PMID: 25586789
  29. CXCR7 overexpression is associated with gastric cancer. PMID: 27716367
  30. CXCL12 may be an effective diagnostic marker for papillary thyroid carcinoma, and CXCL12/CXCR4/CXCR7 axis may contribute to thyroid cancer development by regulating cancer cell migration and invasion via AKT and ERK signaling and MMP-2 activation. PMID: 27082011
  31. Our study suggested that CXCR7 plays an important proangiogenic role in hepatocellular carcinoma (HCC). via activation of the AKT pathway. So CXCR7 may be a potential target for antiangiogenic therapy in HCC PMID: 27572688
  32. CXCR7 is a direct downstream target of miR-100, and overexpression of miR-100 efficiently suppresses CXCR7 expression. PMID: 27035873
  33. Overexpression of CXCR7 is associated with breast cancer. PMID: 27460092
  34. High CXCR7 expression is associated with endometrial cancer. PMID: 26678890
  35. the current study revealed that CXCL12 which combined its receptors CXCR4 and CXCR7 together could promote cell migration and cell invasion of OSCC. PMID: 26232325
  36. Increased CXCR7 expression is associated with invasion in nasopharyngeal carcinoma. PMID: 26715277
  37. Up-regulation of miR-218 expression in renal cell carcinoma under hypoxia can result in significant and targeted down-regulation of CXCR7 expression. PMID: 27133059
  38. CXCR7 affects the growth of PTC cells. PMID: 26383519
  39. CXCR7 may play a role in the progression, metastasis and angiogenesis of otorhinolaryngologic tumours. PMID: 26996902
  40. CXCR4 was co-expressed with all investigated neural and embryonic stem cell markers in both primary and recurrent tissues, whereas CXCR7 was mostly found on stem cell marker-negative cells, but was co-expressed with KLF-4 on a distinct GBM cell subpopulation PMID: 26821357
  41. Expression levels of CXCR4 and CXCR7 in breast cancer tissues were significantly higher than that in adjacent normal tissues and patients with high CXCR4 and CXCR7 expression had a shorter survival time compared with those with low expression. PMID: 26722521
  42. Data shows the relative expression of CXCR4 and CXCR7 in platelets, their dynamic trafficking, how they differentially mediate the functional and survival response to some chemokines, and their prognostic value in coronary artery disease. [review] PMID: 26551719
  43. CXCR7 expression in colorectal carcinoma was correlated with tumor development and poor prognosis of patients. PMID: 26722500
  44. TGFbeta1-CXCR7 axis may be a prognostic marker and may provide novel targets for combinational therapies to be used in the treatment of advanced lung cancer in the future PMID: 26212008
  45. Evidences suggest an indispensable role of GLI1 in the migration and metastasis of breast cancer cells through CXCL12/CXCR4 signaling enhancement. PMID: 26413813
  46. Developmental expression patterns of chemokines CXCL11, CXCL12 and their receptor CXCR7 in testes PMID: 25810367
  47. STAT3 signaling downstream of CXCR7 is involved in miR-101 regulation of breast cancer cell behaviors. PMID: 26360780
  48. CXCR7 is expressed on NogoA- and Nkx2.2-positive oligodendroglial cells in human multiple sclerosis brains. PMID: 26741980
  49. This study found that elevated mRNA levels for CXCR7 (+29%; p<.0001) and CXCR4 (+14%, p=.052) in schizophrenia subjects. PMID: 25464914
  50. the roles of CXCR4, CXCR7, and CXCL12 are associated with trophoblastic cells apoptosis and may be linked to the occurrence and development of severe preeclampsia PMID: 26721717
  51. Dimers CXCR4 and CXCR7 are involved in TFF3-dependent activation of cell migration, but not cell proliferation. The ERK1/2 pathway is activated in the process, but not influenced by CXCR4 or CXCR7. PMID: 26780310
  52. The study shows that CXCR7 is an important modulator of cell proliferation and cell cycle progression of CXCR7-expressing breast cancer cells. PMID: 25168820
  53. Review of the role of chemokine receptors CXCR4/CXCR7 and their primary heterodimeric ligands CXCL12 and CXCL12/high mobility group box 1 in pancreatic cancer growth and development. PMID: 25872129
  54. CXCR4 affects the prognosis of HCC patients but CXCR7 does not. PMID: 25363530
  55. Data indicate that CXC chemokine CXCL14, CXC chemokine receptor CXCR7 and the ratio between CXC chemokine receptor CXCR4-2 and CXCR4-1 could predict diseae free survival in Ewing sarcoma patients. PMID: 26428435
  56. We used western blotting and flow cytometry to detect CXCR4 and CXCR7 expression in two OS cell lines (LM8 and Dunn). An MTT assay was used to evaluate the effects of CXCL12 and AMD3100, a specific CXCR4 antagonist, on cell viability. PMID: 25997540
  57. CXCR7 may regulate growth and metastasis of papillary thyroid carcinoma via the activation of PI3K/AKT pathway and its downstream NF-kappaB signaling, as well as the down-regulation of Notch signaling. PMID: 25887589
  58. Pioglitazone-mediated CXCR7 suppression and macrophage chemotaxis inhibition occur via activating peroxisome proliferator-activated receptor gamma. PMID: 26507929
  59. Knock-down of CXCR-7 expression leads to augmented TRAIL-mediated suppression of MCF-7 cell proliferation and invasion. PMID: 25894375
  60. Overexpression HIF1alpha was related with higher expressions of CXCR7 and CXCR4, otherwise IDH1 mutation related with lower expression of both genes in astrocytomas. PMID: 24970694
  61. platelet surface expression of CXCR4 and CXCR7 was measured by using flow cytometry in 284 patients with symptomatic CAD at the time of percutaneous coronary intervention PMID: 25660395
  62. Blockade of CXCR7 suppressed MIF-mediated ERK- and zeta-chain-associated protein kinase (ZAP)-70 activation PMID: 26139098
  63. CXCR4 and CXCR7 receptors play a role in organ selective homing and invasion. The balance in the expression levels of the two CXCL12 receptors reveals their participation into complex mechanisms controlling metastatic homing PMID: 25955316
  64. CXCL12-mediated cell motility was CXCR7-dependent, with CXCR7 expression required for optimal expression of CXCR4 protein PMID: 25884570
  65. The CXCL12-CXCR7 autocrine loop affects tumor endothelial cell proangiogenic properties. PMID: 26100110
  66. CXCR7 influences prognosis in human glioma in an IDH1-dependent manner. PMID: 26109200
  67. Dual targeting of the chemokine receptors CXCR4 and ACKR3 with novel engineered chemokines. PMID: 26216880
  68. CXCR7 acted as a functional receptor for CXCL12 in brain endothelial cells. PMID: 25084358
  69. Study showed CXCR7 expression upregulated in osteosarcoma (OS) cells and positively correlated with distant metastasis suggesting that CXCR7 may represent a new biomarker involved in the development of OS. PMID: 24969680
  70. CXCR7 may play an important role in the regulation of tumor progression in multiple myeloma (MM) through an indirect effect on the recruitment of angiogenic mononuclear cells to areas of MM tumor growth in the bone marrow niche PMID: 25079359
  71. binding of CXCL12 to CXCR7 activates the ERK and Akt cell-survival pathways in JAR cells PMID: 24450273
  72. We assessed the relative expressions of CXCL12, CXCR4 and CXCR7 in the stroma and the tumour of head and neck squamous cell carcinoma PMID: 25474514
  73. CXCR7 is the predominant chemokine receptor expressed in cutaneous squamous cell carcinoma (SCC) cell lines, and activation of CXCR7 by CXCL12 promotes survival of SCC cells through the ERK pathway. PMID: 25256412
  74. CXCR7 expression is associated with relapse-free survival in estrogen receptor positive breast cancer patients. PMID: 25358600
  75. CXCR7 functions as a positive regulator in the growth and proliferation of SiHa cells and its expression in cervical squamous cell carcinoma leads to biologically more aggressive tumors. PMID: 25422203
  76. High expression rates of CXCR7 is associated with pancreatic adenocarcinoma. PMID: 25407240
  77. CXCR7 participates in the differentiation of HCC by regulating HNF4A. PMID: 25242412
  78. CXCR7 siRNA efficaciously suppressed CCL19-induced AKT. PMID: 25359618
  79. Elevated expression of CXCR7 contributes to hepatocellular carcinoma growth and invasiveness via activation of mitogen-activated protein kinase and angiogenesis signaling pathways. PMID: 25341042
  80. aberrant expression of CXCR7 in the vasculature has the potential to disrupt vascular homeostasis and could contribute to vascular dysfunction in cancer systems. PMID: 24710021
  81. Findings suggest that CXCR4 and CXCR7 closely interact in breast cancer cells. Both are co-internalized, transduce signals and induce further biological effects partly independently of a selective stimulus or antagonist. PMID: 24770893
  82. CXCR7 actively promotes the proliferation and invasive behavior of glioma tumor cells and stem-like progenitor cells. PMID: 25550535
  83. In addition to its capacity to control CXCL12 bioavailability, ACKR3 can either enhance or dampen CXCR4-mediated signaling and activity. PMID: 24853339
  84. We demonstrated, for the first time, that hypoxia upregulated CXCR4 but not CXCR7 expression in tumor cells and that the CXCR4 receptor protein level remains high at the cell membrane when the tumor cells return to normoxia for up to 48 hours PMID: 24629239
  85. High VEGF expression also was the independent adverse prognostic factor for embryonal rhabdomyosarcoma (ERMS). Because CXCR4, CXCR7, and VEGF are widely expressed in rhabdomyosarcoma (RMS). PMID: 25086956
  86. Data suggest that CXC chemokine receptor 7 (CXCR7) potentiates CXC Chemokine Receptor 4 (CXCR4) response and may contribute to the maintenance of leukemia. PMID: 24497931
  87. CXCR7 plays an important role in regulating growth and metastasis ability of papillary thyroid carcinoma (PTC) cell. PMID: 24814201
  88. we performed microarray expression analyses followed by mechanistic analyses to shed light on common or opposed signaling cascades initiated by CXCR4 and CXCR7 in colorectal cancer PMID: 24255072
  89. SDF-1/CXCR7 enhances ovarian cancer cell invasion by upregulation of MMP-9 expression. PMID: 24819308
  90. the correlation between SDF-1, CXCR4 and CXCR7 protein levels in endometrial cancer PMID: 24416254
  91. Expression of TLR4 or CXCR7 is associated with tumor size and lymph node metastasis. PMID: 24363762
  92. The results of the study do not indicate a significant functional role for CXCR7 in squamous cell carcinomas or adenocarcinomas of the esophagus. PMID: 24074251
  93. Expression of the chemokine receptor CXCR7 in CXCR4-expressing human 143B osteosarcoma cells enhances lung metastasis of intratibial xenografts in SCID mice. PMID: 24040160
  94. Study shows that CXCR7 has a critical role in OS progression in the lungs. PMID: 24002596
  95. Our findings unequivocally demonstrate a novel role for CXCR7 in regulating the migration of plasmablasts during B-cell maturation. PMID: 24259140
  96. CXCR7 expression is sufficient to drive post-confluent growth in endothelial cell cultures. We provide a novel mechanism for CXCR7-mediated proliferation via proteasomal degradation of the tumor suppressor protein Rb. PMID: 23894550
  97. integrin-mediated cell-ECM interactions can modulate tumor cell morphology, and regulate the expression of chemokine receptors CXCR7 and CXCR4 which are associated with the invasive phenotype and progression of prostate cancer. PMID: 23921147
  98. CXCR3, CXCR4, CXCR7 have similar transmembrane helices, different conformations of N-terminal, C-terminal regions and extracellular loops, and interaction between the three receptors and CXCL11 and CXCL12 are on a hydrophobic and electrostatic basis. PMID: 23773308
  99. study indicated that the angiogenesis of adipose tissue-derived mesenchymal stem cells (ADSCs) is, at least partly, mediated by SDF-1/CXCR4 and SDF-1/CXCR7 axis. However, only binding of SDF-1/CXCR7 was required for proliferation of ADSCs, and CXCR7 was required for migration of ADSCs induced by SDF-1. PMID: 24184476
  100. the present study reveals for the first time an essential role of CXCR7, together with CXCR4, in the control of CD34+ survival, cell cycling, and colony formation induced by CXCL12. PMID: 24277075

Show More

Hide All

Subcellular Location Cell membrane, Multi-pass membrane protein, Cytoplasm, perinuclear region, Early endosome, Recycling endosome
Protein Families G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Tissue Specificity Expressed in monocytes, basophils, B-cells, umbilical vein endothelial cells (HUVEC) and B-lymphoblastoid cells. Lower expression detected in CD4+ T-lymphocytes and natural killer cells. In the brain, detected in endothelial cells and capillaries, and in
Database Links

HGNC: 23692

OMIM: 610376

KEGG: hsa:57007

STRING: 9606.ENSP00000272928

UniGene: Hs.471751

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1