Recombinant Human Intermediate conductance calcium-activated potassium channel protein 4(KCNN4)

Code CSB-CF012086HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O15554
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFL VKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPA PVRGPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYR SIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDT LWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK LREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLP EPSQQSK
Source in vitro E.coli expression system
Gene Names KCNN4
Protein Names Recommended name: Intermediate conductance calcium-activated potassium channel protein 4 Short name= SK4 Short name= SKCa 4 Short name= SKCa4 Alternative name(s): IKCa1 Short name= IK1 KCa3.1 KCa4 Putative G
Expression Region 1-427
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Forms a voltage-independent potassium channel that is activated by intracellular calcium
Involvement in disease Dehydrated hereditary stomatocytosis 2 (DHS2)
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Potassium channel KCNN family, KCa3.1/KCNN4 subfamily
Tissue Specificity Widely expressed in non-excitable tissues.
Database Links

HGNC: 6293

OMIM: 602754

KEGG: hsa:3783

STRING: 9606.ENSP00000262888

UniGene: Hs.10082

Related Products

KCNN4 Antibodies

KCNN4 Antibodies for Human

KCNN4 Antibodies for Homo sapiens (Human)

KCNN4 Proteins

KCNN4 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.