Recombinant Human Killer cell immunoglobulin-like receptor 3DL1(KIR3DL1)

Code CSB-CF012364HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P43629
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP
Source in vitro E.coli expression system
Gene Names KIR3DL1
Protein Names Recommended name: Killer cell immunoglobulin-like receptor 3DL1 Alternative name(s): CD158 antigen-like family member E HLA-BW4-specific inhibitory NK cell receptor MHC class I NK cell receptor Natural killer-associated transcript 3 Short name
Expression Region 22-444
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor on natural killer (NK) cells for HLA Bw4 allele. Inhibits the activity of NK cells thus preventing cell lysis.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily
Database Links

HGNC: 6338

OMIM: 604946

KEGG: hsa:3811

STRING: 9606.ENSP00000375608

UniGene: Hs.645228

Pathway Antigen processing and presentation
Natural killer cell mediated cytotoxicity

Related Products

KIR3DL1 Antibodies

KIR3DL1 Antibodies for Homo sapiens (Human)

KIR3DL1 Antibodies for Human

KIR3DL1 Proteins

KIR3DL1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.