Recombinant Human Killer cell immunoglobulin-like receptor 3DL1(KIR3DL1)

Code CSB-CF012364HU
Size Pls inquire other sizes
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names KIR3DL1
Uniprot No. P43629
Alternative Names AMB11; CD158 antigen-like family member E; CD158e; CD158e antigen ; CD158E1; CD158E1/2; CD158E2; CL11; CL2; HLA-BW4-specific inhibitory NK cell receptor; KI3L1_HUMAN; killer cell immunoglobulin like receptor; Killer cell immunoglobulin like receptor three domains ; short cytoplasmic tail; 1; Killer cell immunoglobulin like receptor three domains long cytoplasmic tail 1; Killer cell immunoglobulin-like receptor 3DL1; KIR; KIR antigen 3DL1; KIR G1; Kir3dl1; KIR3DS1 ; Kirl1; Kirl2; Krl1; MGC119726; MGC119728; MGC126589; MGC126591; MHC class I NK cell receptor; Natural killer associated transcript 3; Natural killer cell inhibitory receptor; Natural killer-associated transcript 3; NK receptor; NK-associated transcript 10; NK-associated transcript 3; NK-associated transcript 3delIg1; NKAT-3; NKAT10; NKAT3; NKB1; NKB1B; p70 killer cell inhibitory receptor; p70 natural killer cell receptor clones CL 2/CL 11; p70 natural killer cell receptor clones CL-2/CL-11; p70 NK receptor CL-2/CL-11
Species Homo sapiens (Human)
Expression Region 22-444
Target Protein Sequence HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Target Data

Function Receptor on natural killer (NK) cells for HLA Bw4 allele. Inhibits the activity of NK cells thus preventing cell lysis.
Gene References into Functions
  1. human leukocyte antigen (HLA)-Bw4 is associated with susceptibility to psoriatic disease (PsD), but genetic interactions with their cognate ligand, variably expressed killer cell immunoglobulin like receptor (KIR) 3DL1 alleles PMID: 28801811
  2. HLA-Bw4-80(T) and multiple HLA-Bw4 copies in combination with KIR3DL1 are associated with protection against chronic hepatitis C in people who inject drugs by distinct mechanisms. PMID: 28412292
  3. Higher proportion of NK cells expressing inhibitory CD158b and CD158e receptors is associated with significant liver injury in children with chronic hepatitis C. PMID: 28611271
  4. KIR3DL1*0010101 and low mRNA expression is associated with antibody mediated acute rejection and chronic rejection. PMID: 28942035
  5. This study suggests a possible role of killer cell immunoglobulin-like receptors and their ligands in the development of liver damage. The absence of human leucocyte antigen C1 and C2 ligands heterozygosity could lead to less inhibition of natural killer cells and a quicker progression to a high level of fibrosis in patients infected with hepatitis C virus, especially following liver transplantation. PMID: 26717049
  6. KIR loci in terms of copy number and haplotypes are not likely to play a major role in antibody response to measles vaccination. PMID: 28158231
  7. Among 11 discovered KIR genotypes, 6 genotypes showed a considerable role and 4 genotypes could preclude the risk of systemic sclerosis (SSc) disease. significant confounding effects were seen between involved genes in these two combinations: "KIR3DL1; HLA-BW4-Thr80" and "KIR3DL1 -HLA-BW4-A1." PMID: 28120169
  8. The present study for the first time presents the beneficial effects of KIR genotype matching in reducing cGVHD in myeloablative transplant setting using HLA matched (sibling and unrelated) donors. The findings offer a clinically applicable donor selection strategy that can help control cGVHD without affecting the risk of relapse and/or identify patients at a high risk of developing cGVHD PMID: 27341514
  9. the KIR3DL1*001, *005, and *015 polymorphisms are remote from the KIR3DL1-HLA-I interface, the structures of these three KIR3DL1-HLA-I complexes showed that the broader HLA-I specificity of KIR3DL1*005 correlated with an altered KIR3DL1*005 interdomain positioning and increased mobility within its ligand-binding site. PMID: 27045007
  10. evidence that KIR-regulated signaling contributes to Behcet's disease PMID: 27708262
  11. KIR3DL1 in combination with HLA-A and -B alleles bearing the Bw4 motif show strong protective effect against multiple sclerosis in African Americans. PMID: 26866467
  12. Authors results suggest that low cell-surface expression of KIR3DL1 in the presence of the HLA-Bw4 epitope is associated with an increased risk for developing psoriasis. PMID: 26286807
  13. Using depletion studies and Killer immunoglobulin-like receptors-transfected cell lines, demonstrated that the dengue virus NS1 tetramer bound the inhibitory receptor KIR3DL1. PMID: 26439909
  14. KIR3DL1 interaction with HLA-B27 is altered by ankylosing spondylitis associated ERAP1 and enhanced by MHC class I cross-linking PMID: 26321090
  15. In early axial spondyloarthritis and ankylosing spondylitis Dutch patients, no copy number changes were found for KIR3DL1. PMID: 25940819
  16. KIR3DL1 has a protective effect against the more severe manifestations of ankylosing spondylitis. PMID: 26238044
  17. Individuals who carried both KIR3DS1 and Bw4*80I did not remain HIV seronegative longer than those from a control group who were homozygous for HLA-Bw6 and carried no HLA-A locus Bw4 alleles PMID: 25330014
  18. Protective genotypes in HIV infection reflect superior function of KIR3DS1 over KIR3DL1-expressing CD8+ T cells. PMID: 25112829
  19. KIR3DL1-HLA-Bw4 combination and IL28B polymorphism predict response to Peg-IFN and ribavirin with and without telaprevir in chronic hepatitis C patients. PMID: 24929144
  20. the strict conformation of HLA-Bw4 allotypes, held in place by the Glu(76)-Arg(83) interaction, facilitates KIR3DL1 binding, whereas Bw6 allotypes present a platform on the alpha1 helix that is less permissive for KIR3DL1 binding. PMID: 25480565
  21. HIV protective KIR3DL1/S1-HLA-B genotypes influence NK cell-mediated inhibition of HIV replication in autologous CD4 targets. PMID: 24453969
  22. The frequency of KIR3DL1 with HLA-Bw4 was significantly lower in diffuse large B-cell lymphoma patients than in controls. PMID: 24755352
  23. Characterizing Maori and Polynesians is a paucity of HLA-B allotypes recognized by KIR. PMID: 25139336
  24. KIR3DL1 genetic diversity in the Chinese Han population and it's mRNA expression pattern PMID: 24173144
  25. Different KIR3DS1, KIR3DL1 and HLA-Bw4 genotypes and levels of transcripts associate with HIV disease progression. PMID: 24059286
  26. Data indicate the impact of KIR3DL1 polymorphism on peptide-laden HLA recognition. PMID: 24563253
  27. The results of this study found that specific combinations of KIR and their HLA ligands can be either risk factors or protective for immune responses triggering Guillain-Barre Syndrome. PMID: 24367901
  28. HLA-B alleles carrying Bw4 epitope present the highest capability of interaction with KIR3DL1 *001 compared to the HLA-B alleles presenting Bw6. PMID: 23984333
  29. present work has shown that IL-2 and IL-15, cytokines critical for NK cell development and maintenance, greatly stimulate KIR3DL1 reverse promoter activity, but not forward promoter activity PMID: 23328843
  30. Both the nature of KIR3DL1 alleles and the KIR3DL1/S1 allele combination affect the KIR3DL1 NK-cell repertoire in the French population. PMID: 23436464
  31. Report reliable and accurate method for genotyping KIR3DL1/S1 using DNA recovered from plasma. PMID: 23524032
  32. Our data suggest a possible association of KIR/HLA variants and the severity of Gaucher disease. PMID: 23266622
  33. Increased matching between expressed KIR-3DL1 and its ligand HLA-Bw4 was found in Italian patients with paroxysmal nocturnal haemoglobinuria. PMID: 22803950
  34. results show that immunogenetic factors, such as the KIR gene profile, can play a role in tyrosine kinase inhibitor therapy response PMID: 22842045
  35. structure of a human KIR3DL1 receptor bound to HLA-B*5701 complexed with a self-peptide PMID: 22020283
  36. the pattern of inhibitory/activating KIR genes, together with their HLA ligands, is associated with susceptibility to B-cell chronic lymphocytic leukemia and affects the clinical course of this disease PMID: 21726204
  37. KIR3DL1 gene expression is upregulated in intestinal mucosa in active celiac disease. PMID: 21616111
  38. The first Ig domain of KIR3DL1 contacts MHC class I at a secondary site. PMID: 21746965
  39. In this review, KIR3DL1/S1 is described as the most extensively studied of the variable natural killer (NK) cell receptors, exemplifying how variation in all possible parameters of function is recruited to diversify the human NK cell response. PMID: 21690332
  40. The less the KIR/HLA-Cw matched, the more cytotoxic activity was shown in NK cells. PMID: 19549379
  41. Enhanced NK polyfunctionality in HIV slow progressors was dependent upon the coexpression of both KIR3DL1*h/*y and HLA-B*57. PMID: 21471235
  42. Distinct HIV-1 epitopes differentially modulated the binding of KIR3DL1 to HLA-Bw4. PMID: 21471246
  43. It was observed that the Thai population shows polymorphism of the KIR genes and the diversities of KIR genes in Thai differed from other populations. PMID: 21696085
  44. analysis of evolution in the centromeric and telomeric regions of group A and B haplotypes of the human killer cell Ig-like receptor locus PMID: 21206914
  45. genetic polymorphism contributes to pathogenesis of ankylosing spondylitis PMID: 20652381
  46. This finding indicates that the inhibitory KIR3DL1 receptor protects against the development of ankylosing spondylitis and is not simply a passive counterpart of the segregating KIR3DS1 allele encoding the activating receptor. PMID: 20818412
  47. expression levels of KIR3DL1 may be involved in the pathogenesis of ankylosing spondylitis PMID: 20574122
  48. Natural killer (NK) cell receptor KIR3DL1*004 is sequestered in the endoplasmic reticulum of the NK cell where it binds to the chaperone calreticulin and does not induce the unfolded protein response. PMID: 21115737
  49. Results indicate a prominent role for KIR3DL1/HLA-Bw4 interactions in licensing natural killer cells for CD16-mediated effector function. PMID: 20664023
  50. KIR3DL1 and KIR3DS1 allele frequencies were determined by DNA sequencing of the complete coding regions from 100 random unrelated African Americans PMID: 20230527
  51. Killer cell immunoglobulin-like receptor gene polymorphism may be associated with lymphoproliferative diseases of granular lymphocytes. PMID: 20528243
  52. a novel KIR3DL1*072 allele PMID: 20210921
  53. Despite its ability to license NK cells, KIR3DL1*004/HLA-Bw4 is not associated with a reduced risk of HIV infection. PMID: 20887224
  54. Results show that antisense transcripts mediate KIR transcriptional silencing through a novel PIWI-like 28-base small RNA. PMID: 20631304
  55. no association in frequencies of the alleles of these gene in ankylosing spondylitis PMID: 19874556
  56. E2F1 participates in the regulation of the transcriptional activation of the KIR3DL1 gene. PMID: 19176033
  57. Allotypes such as KIR3DL1*004 demonstrate a negative association in patients with ankylosing spondylitis in the presence of HLA-Bw4I80. PMID: 20131260
  58. There may be a association between the polymorphism of KIR genes with systemic lupus erythematosus in North of China. PMID: 18687225
  59. Natural killer (NK) cells from individuals with the genotype KIR3DL1*h/*y/HLA-B*57 combination are associated with the control of human immunodeficiency virus (HIV), particularly in the KIR3DL1-positive NK cell subset. PMID: 20061407
  60. Genotypes without activating KIR genes have higher frequency in patient group. PMID: 19664392
  61. To assess whether KIR ligands, KIR genes and KIR haplotypes are associated with HSCT outcome of 124 patients with various hematological malignancies, transplanted with 12/12 HLA matched grafts from unrelated donors. PMID: 19169284
  62. kir3dl1 expression in K562 cells is regulated by DNA methylation. PMID: 18549610
  63. KIR inhibits activation-induced cell death by blocking Fas ligand induction upon stimulation in a process apparently accomplished by protein kinase C (PKC) recruitment to the membrane-proximal PKC binding site and subsequent inhibition of PKC activation. PMID: 12244166
  64. Allele-specific 3DL1 gene expression correlated with promoter and 5' gene DNA hypomethylation in NK cells in vitro and in vivo. PMID: 12538663
  65. Positive linkage disequilibrium was seen between KIR3DS1 and KIR2DS3, and between KIR3DS1 and KIR2DS5. PMID: 12559621
  66. The promoter of KIR3DL1 exhibits variegated expression in a range of cell types, with reduced activity suggesting a requirement for other regulatory elements for physiological expression compared to the KIR2DL4 promoter. PMID: 12794136
  67. Analysis of recombinant mutants made between KIR3DL1*004 and KIR3DL1*002 alleles shows that polymorphism in immunoglobulin domains 0 and 1 causes intracellular retention of KIR3DL1*004, preventing cell surface expression and function. PMID: 14662867
  68. Decreased expression of NKB1 and GL183 on natural killer (NK) cells in endometrium, but not in myometrium, in women with adenomyosis. May be compensatory effect in which NK cytotoxicity is activated in order to eradicate abnormal endometrial cells. PMID: 15217996
  69. The human leukocyte antigen-Bw4I80 epitope and the KIR3DS1 gene were more frequent in HCV carriers than in patients with hepatocellular carcinoma, and the associations were not independent of each other. PMID: 15942906
  70. KIR3DL1 allotypes contribute to development of an inhibitory response to HLA-Bw4 ligands in transduced natural killer (NK) leukemia cell lines. PMID: 16210627
  71. Presence of KIR3DS1 or KIR3DL1 in combination with HLA-B*27s/HLA-B Bw4-I80 genotypes may modulate the development of ankylosing spondylitis. PMID: 16805919
  72. We took a comprehensive linker-scanning mutagenesis approach and substituted 24 consecutive 10-bp segments in the human KIR3DL1 promoter. Our analysis revealed eight segments that activated and three segments that repressed KIR transcription. PMID: 16818466
  73. This study shows that HLA-A*2402 is a ligand for KIR3DL1 and demonstrates how the binding of KIR3DL1 to Bw4(+) ligands depends upon the bound peptide as well as HLA and KIR3DL1 polymorphism. PMID: 17182537
  74. Inhibitory alleles of KIR3DL1 differ in their ability to recognize HLA-Bw4 ligand, and a consistent hierarchy of ligand reactivity can be defined. PMID: 17182560
  75. KIR3DS1 associates with the ITAM-bearing adaptor, DAP12 PMID: 17202323
  76. In 3DS1/3DL1 heterozygous donors significant numbers of natural killer (NK) cells express 3DS1 without co-expressing 3DL1 and that NK cells expressing both alleles are difficult to detect. PMID: 17301953
  77. Frequency of HLA-Bw4 and -C2, which are ligands for the inhibitory KIRs 3DL1 and 2DL1, respectively, was significantly reduced in Primary sclerosing cholangitis patients as compared with controls PMID: 17383044
  78. This report is comparing KIR genotyping distribution in two Arab populations that sheds additional light on the importance of this gene in delineating a possible geographic genetic demarcation among different ethnicities. PMID: 17385087
  79. Maternal KIR/fetal HLA-Cw gene combinations that are involved in the fetomaternal tolerance do not appear to play a role in the HPA-1a alloimmunization. PMID: 17714418
  80. KIR donor-recipient genotype is not predictive for the outcome of unrelated-donor hematopoietic stem cell tranplantation in patients with beta-Thalassemia. PMID: 17950922
  81. various sequence motifs are implicated in the PKC-mediated post-transcriptional upregulation of KIR, and each of these motifs work in different steps after PKC activation PMID: 18301382
  82. in bone marrow transplant patients alleles 3DL1*00101 & *002 were most frequently observed in addition to 12 other known 3DL1 alleles; A single 3DS1 allele, 3DS1*01301, was identified; two new alleles, 3DL1*01702 and 3DS1*058, were characterized PMID: 18331531
  83. E2F1 contributes to the transcriptional activation of the KIR3DL1 gene. PMID: 18358829
  84. analysis of the ability of most common HLA-B alleles and HLA-A alleles with Bw4 serologic reactivity to protect target cells from lysis by KIR3DL1-dependent NK cells PMID: 18385451
  85. KIR3DL1 evolution maintains variation in KIR3DL1 cell-surface expression levels, potentially due to the effect of such variation on functional capacity. PMID: 18453594
  86. expression of HLA A*2301, A*2402, or A*3201 but not HLA A*2501 protects target cells from lysis by KIR3DL1(+) NK cells PMID: 18502829
  87. The HLA-Cw*0701 allele and KIR haplotype AA are associated with AMD. This genotype combination suggests that natural killer cells have a role in the pathogenesis of AMD. PMID: 18515573
  88. Genetic interactions of KIR and G1M immunoglobulin allotypes differ in obese and non-obese individuals with type 2 diabetes. PMID: 18632158
  89. 3DL1/3DS1 demonstrated an increased frequency in ankylosing spondylitis (p(c) < 0.005 in the Chinese population and p(c) < 0.05 in the Thai population) PMID: 18638658
  90. plays a role in the regulation of GVHD and GVL. (review) PMID: 18800608
  91. Polymorphism at sites throughout the human leukocyte antigen (HLA) class I molecule can influence the interaction of the HLA Bw4 epitope with KIR3DL1. PMID: 18941220
  92. Our data suggest that extensive KIR gene polymorphisms are ubiquitous as well as quite complex. PMID: 19000148
  93. The frequency of KIR3DL1/S1 subtype expression on NK cells contribute to the phenotypic variation across allotypes with respect to disease resistance. PMID: 19008943
  94. KIR/HLA genotype and expression of NKG2C and NKG2D might play a significant role in regulating natural killer cell function and anti-cytomegalovirus immunity after kidney transplantation. PMID: 19032228
  95. The aim of this study was to explore the possibility of the inheritance of KIR genotypes and haplotypes as a candidate for susceptibility to persistent hepatitis B virus (HBV) infection or HBV clearance. PMID: 19118512
  96. The quantity of HLA-I expression on precursor-B-ALL blast regulates overall NK cell susceptibility; in case of reduced HLA expression, differential surface expression of killer cell Ig-like receptor affects NK cell alloreactivity against those blasts. PMID: 19151793
  97. Persistence of KIR3DS1+ and KIR3DL1+ NK cells during acute HIV1 infection is HLA class I-dependent. PMID: 19386717
  98. Studied here is KIR3DL1/S1, which encodes receptors for highly polymorphic human HLA-A and -B and comprises three ancient allelic lineages that have been preserved by balancing selection throughout human evolution PMID: 19411600
  99. Carriage of the ligand of inhibitory KIR3DL1 receptor HLA-Bw4 is found to protect against mltiple sclerosis in an HLA-DRB1 independent manner. PMID: 19630074
  100. Antibody cross-linking of inhibitory receptor KIR3DL1 prevents the autoreactive macrophage killing that characterizes lupus T cells. PMID: 19675166

Show More

Hide All

Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily
Database Links

HGNC: 6338

OMIM: 604946

KEGG: hsa:3811

STRING: 9606.ENSP00000375608

UniGene: Hs.645228

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1