Recombinant Human Palmitoyltransferase ZDHHC17 (ZDHHC17)

Code CSB-CF811600HU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ZDHHC17
Uniprot No.
Alternative Names
ZDHHC17; HIP14; HIP3; HYPH; KIAA0946; HSPC294; Palmitoyltransferase ZDHHC17; Acyltransferase ZDHHC17; DHHC domain-containing cysteine-rich protein 17; DHHC17; Huntingtin yeast partner H; Huntingtin-interacting protein 14; HIP-14; Huntingtin-interacting protein 3; HIP-3; Huntingtin-interacting protein H; Putative MAPK-activating protein PM11; Putative NF-kappa-B-activating protein 205; Zinc finger DHHC domain-containing protein 17
Species
Homo sapiens (Human)
Expression Region
1-632
Target Protein Sequence
MQREEGFNTKMADGPDEYDTEAGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWD IVKATQYGIYERCRELVEAGYDVRQPDKENVTLLHWAAINNRIDLVKYYISKGAIVDQLG GDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKG QDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTV ISLLLEAGANVDAQNIKGESALDLAKQRKNVWMINHLQEARQAKGYDNPSFLRKLKADKE FRQKVMLGTPFLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL GIYLATKFWMYVTWFFWFWNDLNFLFIHLPFLANSVALFYNFGKSWKSDPGIIKATEEQK KKTIVELAETGSLDLSIFCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGAGNHR YFMGYLFFLLFMICWMIYGCISYWGLHCETTYTKDGFWTYITQIATCSPWMFWMFLNSVF HFMWVAVLLMCQMYQISCLGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEF RCCGLFRPVIVDWTRQYTIEYDQISGSGYQLV
Protein Length
full length protein
Tag Info
The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates and is involved in a variety of cellular processes. Has no stringent fatty acid selectivity and in addition to palmitate can also transfer onto target proteins myristate from tetradecanoyl-CoA and stearate from octadecanoyl-CoA. Palmitoyltransferase specific for a subset of neuronal proteins, including SNAP25, DLG4/PSD95, GAD2, SYT1 and HTT. Also palmitoylates neuronal protein GPM6A as well as SPRED1 and SPRED3. Could also play a role in axonogenesis through the regulation of NTRK1 and the downstream ERK1/ERK2 signaling cascade. May be involved in the sorting or targeting of critical proteins involved in the initiating events of endocytosis at the plasma membrane. May play a role in Mg(2+) transport. Could also palmitoylate DNAJC5 and regulate its localization to the Golgi membrane.
Gene References into Functions
  1. Data reveal the structural basis of interaction between DHHC17, and SNAP25b, a canonical substrate. These results show the role of critical residues for substrate binding and palmitate transfer and the involvement of the same residues in binding Huntingtin, another important substrate of DHHC17. PMID: 28757145
  2. The large number of zDABM sequences within the human proteome suggests that zDHHC17 may be an interaction hub regulating many cellular processes. PMID: 28882895
  3. CPj0783 might cause abnormal vesicle-mediated transport by interacting with HIP14. PMID: 27611675
  4. This suggests that altered HIP14-HTT and HIP14L-HTT interactions in the presence of the HD mutation reduces palmitoylation and promotes mislocalization of HTT and other HIP14/HIP14L substrates PMID: 25849918
  5. Data show that deletion of huntingtin protein (HTT) amino acids 1-427 abolishes the interaction of HTT with palmitoyl acyltransferases huntingtin interacting protein 14 (HIP14) and huntingtin interacting protein 14-like (HIP14L). PMID: 24651384
  6. HIP14 shares a high proportion of interactors with HTT resulting in defective palmitoylation of the target proteins which might be an important mechanism towards pathogenesis of Huntington's disease. PMID: 24705354
  7. DHHC17 is a ClipR-59 palmitoyltransferase that modulates ClipR-59 plasma membrane binding. PMID: 24001771
  8. Low levels of human HIP14 are sufficient to rescue neuropathological, behavioural, and enzymatic defects due to loss of murine HIP14 in Hip14-/- mice. PMID: 22649491
  9. Immunohistochemical analysis of pancreatic sections demonstrated that HIP14 is almost exclusively expressed in insulin-positive cells in islets of Langerhans. PMID: 21705657
  10. Novel peptides have been developed that target the jun N-terminus kinase (JNK)-interacting motif on zD17 to selectively block enhancement of the zD17-Jun N terminus kinase (JNK) interaction and the activation of JNK isoforms 2 and 3. PMID: 21849558
  11. a subset of DHHCs controls STREX palmitoylation and function; DHHC17 may preferentially target cysteine-rich domains PMID: 20507996
  12. Coexpression of an independent palmitoyl acyltransferase (HIP14) with the GODZ-DHHS mutant also rescued Ca(2+) transport. PMID: 19955568
  13. has the ability to induce colony formation in cell culture, anchorage-independent growth, and tumors in mice PMID: 15489887
  14. huntingtin interacting protein genes, HIP14 and HIP14L, encode Mg2+ transport proteins that are regulated by their innate palmitoyl acyltransferases thus fulfilling the characteristics of "chanzymes." PMID: 18794299
  15. The ankyrin repeat domain of Huntingtin interacting protein 14 contains a surface aromatic cage, a potential site for methyl-lysine binding. PMID: 19434754
  16. HIP14 is a protein: palmitoyl acyltransferase PMID: 15489887

Show More

Hide All

Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, presynaptic cell membrane; Multi-pass membrane protein.
Protein Families
DHHC palmitoyltransferase family, AKR/ZDHHC17 subfamily
Tissue Specificity
Expressed in all brain regions. Expression is highest in the cortex, cerebellum, occipital lobe and caudate and lowest in the spinal cord. Expression is also seen in testis, pancreas, heart and kidney.
Database Links

HGNC: 18412

OMIM: 607799

KEGG: hsa:23390

STRING: 9606.ENSP00000403397

UniGene: Hs.4014

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 322 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join Us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1