Recombinant Human Putative synaptogyrin-2 like protein

Code CSB-CF427559HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A8MWL6
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MESGAYGVAEAGGSFDLRPFLTQPQVVARALCLVFALIVFSCIYGEGYSNTHKSKQMYCV FNHNEDACRYGSAIGVLAFLASAFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFV GFCFLTNQWAVTDPEDVLVGADSARAAITFSFFSIFSWGVLASLTYQRYKAGVDDFIQNY VDPSPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY
Source in vitro E.coli expression system
Protein Names Recommended name: Putative synaptogyrin-2 like protein
Expression Region 1-223
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Synaptogyrin family

Related Products

Proteins

Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.