Recombinant Human Transmembrane protease serine 11D (TMPRSS11D)

Code CSB-CF023918HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
TMPRSS11D
Uniprot No.
Alternative Names
TMPRSS11D; HAT; Transmembrane protease serine 11D; Airway trypsin-like protease
Species
Homo sapiens (Human)
Expression Region
1-186
Target Protein Sequence
MYRPARVTSTSRFLNPYVVCFIVVAGVVILAVTIALLVYFLAFDQKSYFYRSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRAHVAKLRQDGSGVRADVVMKFQFTRNNNGASMKSRIESVLRQMLNNSGNLEINPSTEITSLTDQAAANWLINECGAGPDLITLSEQR
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions. Plays a role in the proteolytic processing of ACE2. Proteolytically cleaves and activates the human coronavirus 229E (HCoV-229E) spike glycoprotein which facilitate virus-cell membrane fusions; spike proteins are synthesized and maintained in precursor intermediate folding states and proteolysis permits the refolding and energy release required to create stable virus-cell linkages and membrane coalescence. Preferentially cleaves the C-terminal side of arginine residues at the P1 position of certain peptides, cleaving Boc-Phe-Ser-Arg-4-methylcoumaryl-7-amide most efficiently and having an optimum pH of 8.6 with this substrate.
Gene References into Functions
  1. High HAT expression is associated with Idiopathic pulmonary fibrosis. PMID: 29122847
  2. we conclude that TMPRSS11D could play a role in non-small cell lung cancer development and progression PMID: 28086212
  3. HAT expression may potentially be useful as a marker for clinical grading and assessment of patient prognosis in squamous cell carcinomas PMID: 26297835
  4. H9N2 viruses with R-S-S-R or R-S-R-R cleavage sites in hemagglutinin are activated by matriptase in addition to HAT and TMPRSS2 and, therefore, can be activated in a wide range of tissues what may affect virus spread, tissue tropism and pathogenicity. PMID: 23192872
  5. TMPRSS2 and HAT are expressed by important influenza and SARS-coronavirus target cells and could thus support viral spread in the human host. PMID: 22558251
  6. results suggest that HAI-1 functions as a physiological regulator of HAT by inhibiting its protease activity and proteolytic activation in airway epithelium.(HAT) PMID: 22023801
  7. HAT cleaves proMSP at the physiological activation site PMID: 22245154
  8. Human HAT cleaved severe acute respiratory syndrome coronavirus spike protein at R667, as determined by mutagenesis and mass spectrometry. PMID: 21994442
  9. HAT regulates cellular functions of human bronchial epithelial cells via activation of protease-activated receptor-2. PMID: 12630574
  10. HAT might promote PAR-2-mediated IL-8 production to accumulate inflammatory cells in the epidermal layer of psoriasis. PMID: 15102084
  11. results indicate that HAT stimulates fibroblast proliferation in bronchial airways through a PAR-2-dependent MEK-MAPK mediated pathway and that HAT is linked to airway processes involving fibroblasts PMID: 16199437
  12. HAT induces amphiregulin production through the PAR-2 mediated ERK pathway, and then causes amphiregulin release by a TACE-dependent mechanism PMID: 16336275
  13. TMPRSS2 and HAT are candidates for proteolytic activation of influenza viruses in vivo PMID: 16973594

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein. Note=Activated by cleavage and secreted.; [Transmembrane protease serine 11D catalytic chain]: Secreted. Note=Activated by cleavage and secreted.
Protein Families
Peptidase S1 family
Tissue Specificity
Located in the cells of the submucosal serous glands of the bronchi and trachea.
Database Links

HGNC: 24059

OMIM: 605369

KEGG: hsa:9407

STRING: 9606.ENSP00000283916

UniGene: Hs.132195

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×