Recombinant Methanocaldococcus jannaschii Molybdate/tungstate transport system permease protein wtpB(wtpB)

Code CSB-CF704452MRU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q58763
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Sequence MEKFDIAMTVFLVMIFLFIFLPIIYMLSNPGDLNQLLDKEVIEAFKTTLLAGAVATLIAL IFGIPTGYILARYDFKFKSFVEAVLDLPMAIPHSVIGIIILSFIYGIDIINFIGRYVVDN FWGIVTVYLFVGIPFMVNSIRDGFLSVDEEIEYVSRTLGASKIRTFFEISLPLIKNNIIS GIILSFARGISEVGAILIIAYYPKTVPILIYERFMSFGLDASKPISVGMILISIALFALL RMFGRMRGR
Source in vitro E.coli expression system
Gene Names wtpB
Protein Names Recommended name: Molybdate/tungstate transport system permease protein wtpB
Expression Region 1-249
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the ABC transporter complex WtpABC involved in molybdate/tungstate import. Probably responsible for the translocation of the substrate across the membrane (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Binding-protein-dependent transport system permease family
Database Links

KEGG: mja:MJ_1368

STRING: 243232.MJ_1368

Related Products

wtpB Proteins

wtpB Proteins for Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.