Recombinant Mouse ATP-binding cassette sub-family G member 5 (Abcg5)

Code CSB-CF858786MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Abcg5; ATP-binding cassette sub-family G member 5; Sterolin-1
Species
Mus musculus (Mouse)
Expression Region
1-652
Target Protein Sequence
MGELPFLSPEGARGPHINRGSLSSLEQGSVTGTEARHSLGVLHVSYSVSNRVGPWWNIKS CQQKWDRQILKDVSLYIESGQIMCILGSSGSGKTTLLDAISGRLRRTGTLEGEVFVNGCE LRRDQFQDCFSYVLQSDVFLSSLTVRETLRYTAMLALCRSSADFYNKKVEAVMTELSLSH VADQMIGSYNFGGISSGERRRVSIAAQLLQDPKVMMLDEPTTGLDCMTANQIVLLLAELA RRDRIVIVTIHQPRSELFQHFDKIAILTYGELVFCGTPEEMLGFFNNCGYPCPEHSNPFD FYMDLTSVDTQSREREIETYKRVQMLECAFKESDIYHKILENIERARYLKTLPTVPFKTK DPPGMFGKLGVLLRRVTRNLMRNKQAVIMRLVQNLIMGLFLIFYLLRVQNNTLKGAVQDR VGLLYQLVGATPYTGMLNAVNLFPMLRAVSDQESQDGLYHKWQMLLAYVLHVLPFSVIAT VIFSSVCYWTLGLYPEVARFGYFSAALLAPHLIGEFLTLVLLGIVQNPNIVNSIVALLSI SGLLIGSGFIRNIQEMPIPLKILGYFTFQKYCCEILVVNEFYGLNFTCGGSNTSMLNHPM CAITQGVQFIEKTCPGATSRFTANFLILYGFIPALVILGIVIFKVRDYLISR
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
ABCG5 and ABCG8 form an obligate heterodimer that mediates Mg(2+)- and ATP-dependent sterol transport across the cell membrane. Plays an essential role in the selective transport of dietary plant sterols and cholesterol in and out of the enterocytes and in the selective sterol excretion by the liver into bile. Required for normal sterol homeostasis. The heterodimer with ABCG8 has ATPase activity.
Gene References into Functions
  1. ABCG5 and ABCG8 mRNA levels were significantly increased in cholesterol group and less increased in myriocin group, relative to that in normal group. PMID: 28268212
  2. The ABCG5/G8-independent pathway plays an important role in regulating biliary cholesterol secretion, and gallstone formation, which works independently of the ABCG5/G8 pathway. PMID: 27014967
  3. ABCG5/G8 mediate mass biliary cholesterol secretion but not from a reverse cholesterol transport-relevant pool. PMID: 26520893
  4. AdGRP78 reduced expression of lipogenic genes and plasma triglycerides in the db/db strain. Both G5 and G8 protein levels increased as did total biliary cholesterol PMID: 26365598
  5. The data demonstrate that Abcg5/Abcg8 deficiency reduces the uptake and secretion of both dietary triacylglycerols and cholesterol by the intestine, suggesting a novel role for the sterol transporter in the formation and secretion of chylomicrons. PMID: 25676339
  6. Sitosterolemia is caused by a genetic defect of sterolins (ABCG5/ABCG8) mapped to the STSL locus. Polymorphic variations in STSL have been linked to lipid levels and gallstone disease PMID: 24811295
  7. The absence of an ABCG5/ABCG8 expression. PMID: 25060694
  8. Mice with deficient Abcg2 have features of inflammatory DCM and that the reversibility of myocardial T cell infiltration provides a novel model for investigating the progression of myocardial fibrosis. PMID: 23129576
  9. biliary cholesterol mass secretion under maximal bile salt-stimulated conditions is fully dependent on ABCG5/G8 PMID: 23401258
  10. This study is the first to report such toxic effects of phytosterol accumulation in ABCG5/G8 knockout mice. PMID: 23380580
  11. The ability of triiodothyronine to stimulate the secretion of cholesterol into bile is largely mediated by the ABCG5/G8 complex. PMID: 22829162
  12. handling of sterols by the intestine involves both G5G8 and ACAT2 but that an additional factor (possibly Niemann-Pick C1-like 1) may be key in determining absorption efficiency PMID: 22669916
  13. The ABCG5 ABCG8 sterol transporter opposes the development of fatty liver disease and loss of glycemic control independently of phytosterol accumulation PMID: 22715101
  14. ABCG5/G8 deficiency in mice markedly raises triglyceride levels by impairing triglyceride catabolism and by increasing liver and intestinal triglyceride secretion. PMID: 21855652
  15. NPC2 is a positive regulator of biliary cholesterol secretion via stimulation of ABCG5/G8-mediated cholesterol transport. PMID: 21315718
  16. NBD1, although not required for ATP hydrolysis, is essential for normal function of G5G8 in sterol transport PMID: 21209088
  17. Disruption in Abcg5 gene is associated with thrombocytopenia and cardiomyopathy. PMID: 19846887
  18. regulation by liver X receptors alpha and beta PMID: 11901146
  19. Although a large number of polymorphic variants were identified, strains reported to show significant differences in cholesterol absorption rates did not show significant genomic variations in Abcg5 or Abcg8. PMID: 11907139
  20. biliary cholesterol secretion by ABCG5 and ABCG8 PMID: 12208859
  21. expression, dimerization, and transport of ABCG5 and ABCG8 PMID: 12208867
  22. ABCG5 and ABCG8 are required for efficient secretion of cholesterol into bile and that disruption of these genes increases dramatically the responsiveness of plasma and hepatic cholesterol levels to changes in dietary cholesterol content. PMID: 12444248
  23. A role for Abcg5 and Abcg8 in regulation of biliary cholesterol secretion. Also, existence of largely independent route of cholesterol secretion. PMID: 12763362
  24. endotoxin significantly decreased mRNA levels of ABCG5 and ABCG8 in the liver, but not in the small intestine PMID: 12777468
  25. ABCG5 and ABCG8 function as obligate heterodimers to promote sterol excretion into bile PMID: 14504269
  26. Disruption of the Abcg5 gene alone is sufficient to cause hyperabsorption of dietary plant sterols and sitosterolemia in mice, whereas the ability to secrete cholesterol into bile is maintained. PMID: 14699507
  27. Abcg5 and Abcg8 in the jejunum and ileum, but not in the duodenum, were main factors in determining, in part, variations in Ch absorption efficiency. PMID: 15102882
  28. The PERA allele of Abcg5/Abcg8, on chromosome 17, is responsible for lithogenicity underlying the Lith9 cholelithiasis QTL. PMID: 16151694
  29. aging significantly enhances cholesterol absorption by suppressing expression of the jejunal and ileal sterol efflux transporter Abcg5 PMID: 16179600
  30. Our data confirm that Abcg5, as part of the Abcg5/Abcg8 heterodimer, strongly controls hepatobiliary cholesterol secretion in mice. PMID: 16614371
  31. G5 and G8 are sufficient for reconstitution of sterol transfer activity in vitro and provide the first demonstration that sterols are direct transport substrates of the G5 and G8 heterodimer. PMID: 16867993
  32. distinct roles for liver and intestinal ABCG5/G8 in modulating sterol metabolism and atherosclerosis in abcg5 transgenic mice. PMID: 17060690
  33. levels of the ABCG5-ABCG8 sterol transporter in liver are regulated by the leptin axis PMID: 17561514
  34. Cholesterol secretion was highly bile salt dependent, whereas other cholesterol acceptors such as ApoAI, HDL or methyl-beta-cyclodextrin did not elicit Abcg5/g8 dependent cholesterol secretion PMID: 17825296
  35. Mutations in either ABCG5 or ABCG8 cause sitosterolemia, an inborn error of metabolism characterized by high plasma plant sterol concentrations. PMID: 18156627
  36. The cholesterol transporters Npc1l1, Abca1, Abcg5, and Abcg8 were found to be downregulated after 2, 4, and 8 wk on a cholesterol-free, high-fat diet. PMID: 18356535
  37. Both ABCG5 (G5) and ABCG8 (G8) have short but highly conserved cytoplasmic tails PMID: 18402465
  38. Increased biliary cholesterol excretion in Atp8b1-deficient mice is independent of Abcg5/8 activity. PMID: 18466903
  39. LXR activation stimulated the fecal excretion of labeled cholesterol after an intravenous injection of HDL-[(3)H]cholesteryl oleate in G5/G8(+/+) mice, but failed to enhance fecal [(3)H]cholesterol in G5/G8(-/-) mice. PMID: 18509196
  40. Abcg5 (-/-) mice, develop sitosterolemia, a genetic disorder characterized by the accumulation of phytosterols in blood and tissues PMID: 18796403
  41. In the liver, histone H3 in the proximal promoter of Abcg5 is hyperacetylated, whereas acetylation in the kidney and the cerebrum is minimal. PMID: 19047482

Show More

Hide All

Involvement in disease
A spontaneous mutation gives raise to thrombocytopenia and cardiomyopathy (trac), with recessive inheritance and fully penetrant phenotype. Mice are small, infertile, and have shortened lifespan.
Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Tissue Specificity
Detected in liver and jejunum. Detected on enterocyte villi (at protein level). Expressed in jejunum, ileum and, at lower level, in the liver.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1