Recombinant Mouse Proto-oncogene Mas (Mas1)

Code CSB-CF013505MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Mas1; Mas; Mas-1; Proto-oncogene Mas
Species
Mus musculus (Mouse)
Expression Region
1-324
Target Protein Sequence
MDQSNMTSLAEEKAMNTSSRNASLGSSHPPIPIVHWVIMSISPLGFVENGILLWFLCFRM RRNPFTVYITHLSIADISLLFCIFILSIDYALDYELSSGHHYTIVTLSVTFLFGYNTGLY LLTAISVERCLSVLYPIWYRCHRPKHQSAFVCALLWALSCLVTTMEYVMCIDSGEESHSR SDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIIIFLIFA MPMRVLYLLYYEYWSAFGNLHNISLLFSTINSSANPFIYFFVGSSKKKRFRESLKVVLTR AFKDEMQPRRQEGNGNTVSIETVV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts specifically as a functional antagonist of AGTR1 (angiotensin-2 type 1 receptor), although it up-regulates AGTR1 receptor levels. Positive regulation of AGTR1 levels occurs through activation of the G-proteins GNA11 and GNAQ, and stimulation of the protein kinase C signaling cascade. The antagonist effect on AGTR1 function is probably due to AGTR1 being physically altered by MAS1. Receptor for angiotensin 1-7.
Gene References into Functions
  1. These results were supported by the opposite outcomes observed for cells treated with A779 or DX600. Therefore, it was concluded that the ACE2-Ang(17)-Mas axis significantly inhibits pancreatitis by inhibition of the p38 MAPK/NF-kappaB signaling pathway PMID: 29138810
  2. important factor in macrophage function during inflammation of the central nervous and vascular system PMID: 27872279
  3. This study aimed to define whether sex chromosome complement (SCC) may differentially modulate sex differences in relative gene expression of basal Agtr1a, Agtr2, and Mas1 receptors at fore/hindbrain nuclei and at medulla/cortical kidney. PMID: 28254489
  4. MasR deficiency abolishes protection of female mice from obesity-induced hypertension PMID: 27986659
  5. Results suggest that angiotensin converting enzyme 2 may reduce anxiety-like behavior by activating central Mas receptor that facilitate GABA release onto pyramidal neurons within the basolateral amygdala. PMID: 26767952
  6. impairment of the ANG-(1-7)/Mas receptor pathway may lead to worsening of the pathophysiological changes of asthma. PMID: 27815255
  7. The data indicate a significant function of Ang-(1-7) in the regulation of insulin secretion from mouse islets in vitro and in vivo, mainly, but not exclusively, by Mas-dependent signaling, modulating the accessory pathway of insulin secretion via increase in cAMP. PMID: 27715254
  8. This study suggests that deletion of AT2R decreases the expression of the beneficial ACE2/Ang-(1-7)/MasR. PMID: 27496559
  9. Ang-(1-7)/Mas axis seems more important in autonomic modulation of arterial pressure than heart rate. PMID: 27080540
  10. Mas receptor mediates cardioprotection of angiotensin-(1-7) against Ang II-induced cardiomyocyte autophagy and cardiac remodelling through inhibition of oxidative stress. PMID: 26515045
  11. MAS receptors mediate vasoprotective and atheroprotective effects of candesartan upon the recovery of vascular ACE2-angiotensin-(1-7)-MAS axis functionality PMID: 26144375
  12. Mas receptor deficiency results in exacerbated inflammation in LPS-challenged mice, which suggest a potential role for the Mas receptor as a regulator of systemic and brain inflammatory response induced by LPS. PMID: 26297425
  13. a Mas receptor-mediated mechanism may stimulate pancreatic cell development PMID: 26029927
  14. Hydronephrosis led to an increase of ACE level and a decrease of ACE2 and Mas receptor in the heart. PMID: 25650385
  15. TGF-beta inhibits Mas receptor expression in fibroblasts but not in myoblasts or differentiated myotubes in animal model of muscular distrophy. PMID: 25809912
  16. Deletion of the MasR causes marked increase in the aortic intima:media ratio, which is not due to generalized cellular proliferation. PMID: 25676544
  17. The complete mouse Mas gene structure and organization. PMID: 26003294
  18. Participation of AT1 and Mas receptors in the modulation of inflammatory pain. PMID: 25169953
  19. Ang-(1-7) counteracts the skeletal muscle atrophy induced by AngII through a mechanism dependent on the Mas receptor, which involves AKT activity. PMID: 25222828
  20. Receptor MAS protects mice against hypothermia and mortality induced by endotoxemia by inhibiting cytokine production. PMID: 24430551
  21. deletion of Mas did not alter cell proliferation in adult dentate gyrus and did not alter cell death; Mas deficiency resulted in an increase in the number of doublecortin (DCX) positive cells; demonstrated Mas deficiency has an impact on cell division and on the population of DCX-positive cells within the piriform cortex PMID: 23860355
  22. Ang-(1-7) decreases the expression and further biological activity of TGF-beta1 induced by angiotensin II PMID: 24588264
  23. The influence of angiotensin-(1-7) Mas receptor agonist (AVE 0991) on mitochondrial proteome in kidneys of apoE knockout mice. PMID: 23988828
  24. exogenous activation of the Mas receptor protects from adriamycin-induced nephropathy. PMID: 23762470
  25. Mas appears to be a critical component required for NO-mediated vasodilatation induced by renin angiotensin system-dependent and RAS-independent agonists and therefore arises as a key pharmacological target to modulate endothelial function PMID: 23459756
  26. Control of adipogenesis by the autocrine interplays between angiotensin 1-7/Mas receptor and angiotensin II/AT1 receptor signaling pathways. PMID: 23592774
  27. Data indicate that Bdkrb2(-/-) mice have elevated plasma angiotensin-(1-7) and messenger RNA and protein for its receptor Mas. PMID: 23386129
  28. Wild-type controls under high-salt diet show a significant increase in blood pressure compared to basal condition. In contrast to wild-type controls, blood pressure rise was completely abolished in Mas-deficient animals. PMID: 22652430
  29. Upregulation of the angiotensin-converting enzyme 2/angiotensin-(1-7)/Mas receptor axis in the heart and the kidney of growth hormone receptor knock-out mice. PMID: 22947377
  30. Severe acute pancreatitis is associated with upregulation of the ACE2-angiotensin-(1-7)-Mas axis and promotes increased circulating angiotensin-(1-7). PMID: 23127535
  31. These results suggest that the Ang-(1-7)/Mas axis plays an important role in regional and systemic hemodynamic adjustments in mice. PMID: 23045193
  32. Data show that in angiotensin II type 1a receptor knockout mice, mRNA expression and immunostaining of ACE2 and Mas in the injured artery were greater, with less neointimal formation than in wild-type mice. PMID: 22665126
  33. Mas receptor alters the response of adipocytes to insulin and regulates the expression of PPARgamma PMID: 22119778
  34. The distribution of Mas within the murine brain, was examined. PMID: 22362508
  35. Activation of Mas during myocardial infarction contributes to ischemia-reperfusion injury and suggest that inhibition of Mas-G(q) signaling may provide a new therapeutic strategy directed at cardioprotection. PMID: 22003054
  36. Angiotensin-converting enzyme 2-Ang(1-7)-Mas axis serves as an important endogenous physiological counterbalancing mechanism that partially attenuates the hypertensinogenic actions of the activated renin-angiotensin system. PMID: 21071955
  37. Proto-oncogene protein Mas are essential in mediating the endothelium-dependent relaxation response induced by perivascular adipose tissue. PMID: 21820449
  38. Data show that the lack of Mas receptor induced important imbalance in the neural control of blood pressure, altering not only the baroreflex but also the chemo- and Bezold-Jarisch reflexes. PMID: 20603170
  39. We conclude that renal nuclei express Ang-(1-7)/Mas receptors that are functionally linked to nitric oxide formation PMID: 20810609
  40. Ang-(1-7) produces vascular effects in isolated, perfused mouse hearts involving interaction of its receptor with angiotensin type 1- and type 2-related mechanisms, leading to release of prostaglandins and nitric oxide. PMID: 16157793
  41. Mas can hetero-oligomerize with the AT1 receptor and by so doing inhibit the actions of angiotensin II PMID: 15809376
  42. Ang-(1-7) influences the induction of LTP in limbic structures, implicating it in learning and memory; we also identified Mas as a functional receptor for Ang-(1-7) in the brain. PMID: 15950155
  43. Ang-(1-7)-Mas axis plays a key role in the maintenance of the structure and function of the heart. (Angiotensin-(1-7) receptor Mas) PMID: 16567589
  44. Our data suggest that Ang-(1-7) antithrombotic effect involves Mas-mediated NO release from platelets. We also showed that the antithrombotic effect of Ang-(1-7) in vivo is Mas dependent and that Mas is functionally important in hemostasis. PMID: 18026570
  45. angiotensin-(1-7)-Mas axis has important functional implications for vascular regulation and blood pressure control--REVIEW PMID: 18156169
  46. key role for the Ang-(1-7)/Mas axis as a modulator of cardiomyocyte function PMID: 18695148
  47. Mas acts as a critical regulator of renal fibrogenesis by controlling effects transduced through angiotensin II AT1 receptors in the kidney PMID: 19262461

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1