Recombinant Mouse Small conductance calcium-activated potassium channel protein 1(Kcnn1)

Code CSB-CF884133MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9EQR3
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MSSHSHNGSVGQPLGSGPGFLGWEPVDPEAGRPLQPTQGPGLQMVAKGQPVRLSPGGSRG HPQEQEEEEEEEEEEDKTGSGKPPTVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVT ETELSWGVYTKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMTW ERVSLISLELVVCAIHPVPGHYRFTWTARLAFSLVPSAAEADLDVLLSIPMFLRLYLLAR VMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAWTVRV CERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVA VVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQGRVRKH QRKFLQAIHQAQKLRSVKIEQGKVNDQANTLAELAKAQSIAYEVVSELQAQQEELEARLA ALESRLDVLGASLQALPGLIAQAICPLPPPWPGPGHLATATHSPQSHWLPTMGSDCG
Source in vitro E.coli expression system
Gene Names Kcnn1
Protein Names Recommended name: Small conductance calcium-activated potassium channel protein 1 Short name= SK1 Short name= SKCa 1 Short name= SKCa1 Alternative name(s): KCa2.1
Expression Region 1-537
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization. The channel is blocked by apamin (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Potassium channel KCNN family, KCa2.1/KCNN1 subfamily
Tissue Specificity Highest expression in brain and liver with lower levels in heart, testis, kidney and colon. In colon, detected in smooth muscle cells. Expressed in atrial and ventricular myocytes with higher levels in atrial myocytes.
Database Links

KEGG: mmu:84036

STRING: 10090.ENSMUSP00000105705

UniGene: Mm.32074

Related Products

Kcnn1 Proteins

Kcnn1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.