Recombinant Mouse Trimeric intracellular cation channel type A(Tmem38a)

Code CSB-CF663629MO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Tmem38a
Uniprot No. Q3TMP8
Alternative Names Tmem38a; Trimeric intracellular cation channel type A; TRIC-A; TRICA; 27 kDa sarcoplasmic reticulum protein; Mitsugumin-33A; SPR-27; Transmembrane protein 38A
Species Mus musculus (Mouse)
Expression Region 1-298
Target Protein Sequence MDLMSALSLGELALSFSRVPLFPVFDLSYFIVSIIYLKYEPGAVELSRRHPVASWLCAML HCFGSYILADLLLGEPIIDYFSNSSSILLASGVWYLIFFCPLDLFYKCVCFLPVKLIFVA MKEVVRVRKIAVGIHHAHHHYHHGWFIMIATGWVKGSGVALLSNVEQLLRGVWKPETNEI LHMSFPTKASLYGAILFTLQQTRWLPVSKASLIFVFTMFMVSCKVFLTATHSHSSPFDIL EGYICPVLFGATWGGDHHHDNHGAPHGMGLGTQHSGLPAKAKEELGEGSRKKKTKKAD
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Monovalent cation channel required for maintenance of rapid intracellular calcium release. May act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores.
Gene References into Functions
  1. Three muscle-specific nuclear membrane proteins, NET39, Tmem38A, and WFS1, direct specific myogenic genes to the nuclear periphery to facilitate their repression during myogenesis. PMID: 27264872
  2. TRIC-A and TRIC-B seem to have differential functions in Ca(2+) signaling in excitable and nonexcitable cells. PMID: 24526676
  3. TRIC-A channel density in VSMCs is responsible for controlling basal blood pressure at the whole-animal level. PMID: 23592776
  4. TRIC-A channels contribute to maintaining blood pressure, while TRIC-A SNPs could provide biomarkers for constitutional diagnosis and personalized medical treatment of essential hypertension. PMID: 21803293
  5. Absence of TRIC-A leads to instability of Ca(2+) movement across the sarcoplasmic reticulum membrane. PMID: 20858894
  6. TRIC channels are likely to act as counter-ion channels that function in synchronization with Ca2+ release from intracellular stores PMID: 17611541

Show More

Hide All

Subcellular Location Sarcoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus membrane.
Protein Families TMEM38 family
Tissue Specificity Expressed at high levels in heart and striated muscle. Also detected in brain, lung and kidney.
Database Links

KEGG: mmu:74166

STRING: 10090.ENSMUSP00000034244

UniGene: Mm.212927

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St Ste 610-322 Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1