Recombinant Oenothera berteriana Cytochrome c oxidase subunit 2(COX2)

Code CSB-CF015073OAR
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P05490
Storage Buffer Tris-based buffer,50% glycerol
Species Oenothera berteroana (Bertero's evening primrose)
Sequence MIVNECLFFTIALCDAAEPWQLGFQDAATPMMQGIIDLHHDILFFLILILVFVLWILVRA LWHFYYKKNPIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAMTLKA IGHQWYWTYEYSDYNSSDEQSLTFDSYMIPEDDLELGQLRLLEVDNRVVVPVKTNLRLIV TSADVLHSWAVPSLGVKCDAVPGRLNQISMLVQREGVYYGQCSEICGTNHAFMPIVIEAV SATDYTNWVSNLFIPPTS
Source in vitro E.coli expression system
Gene Names COX2
Protein Names Recommended name: Cytochrome c oxidase subunit 2 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide II
Expression Region 1-258
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.
Subcellular Location Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families Cytochrome c oxidase subunit 2 family

Related Products

COX2 Proteins

COX2 Proteins for Oenothera berteroana (Bertero's evening primrose)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.