Recombinant Pig Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 7(GCNT7)

Code CSB-CF009332PI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A5GFW8
Storage Buffer Tris-based buffer,50% glycerol
Species Sus scrofa (Pig)
Sequence MSQLRATKPGILVCAAIGIFVFLYLRNPTSEDPEEGPTHPAVVECGFYPDELCSALFEGKEAALQIAKFCKDPHGSEIVARLHRPGNCSRISRELHFITRPLSAEEGTFPLAYIVTIHKELALFVQLLRAIYLPQNVYCIHVDAKAPKKYKTAVQSLVNCFENIFISSKREKVAYTGFRRLQAEINCMKDLVHSKFQWSHVINLCGQDFPIKTNKDIIRYIRSKWNDKNITPGVIQPPSNKSKTSQTHREFTPEGNIYASPNERFRDDPPHNLTIYFGSASYVLTRKFVEFVLTDTRAKDMLRWSQDIHGPERHYWVTLNRLKDAPGSTPNAGWEGNVRAVKWRSEEGTVRDGCKGRYVQDSCVYGPGDLPWIIQSPSLFASQFDSAEPLVVTCLERWHRLRVLGQAEVPEEPHWHFQRESHLNRRLNP
Source in vitro E.coli expression system
Gene Names GCNT7
Protein Names Recommended name: Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 7 EC= 2.4.1.-
Expression Region 1-429
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Glycosyltransferase.
Subcellular Location Golgi apparatus membrane, Single-pass type II membrane protein
Protein Families Glycosyltransferase 14 family
Database Links

KEGG: ssc:100134987

STRING: 9823.ENSSSCP00000007989

UniGene: Ssc.69922

Related Products

GCNT7 Proteins

GCNT7 Proteins for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.