Recombinant Populus trichocarpa Casparian strip membrane protein POPTRDRAFT_763057 (POPTRDRAFT_763057)

Code CSB-CF496204EXS
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B9HBX2
Storage Buffer Tris-based buffer,50% glycerol
Species Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Sequence MKSESAAIDIPESSSVAKGKAPLIAVSRNEKGGYRKGIAIFDFILRLAAIATALAAAAAM GTSDETLPFFTQFFQFQASYDDLPTFQFFVIAIAIVGGYLVLSLPFSIVAIVRPHAVGPR LLLIILDAVALTLNTAAGAAAAAIVYLAHNGNSNTNWLAICQQYGDFCQKVSGAVVASFI TVVIFVFLIVLSAFALRRH
Source in vitro E.coli expression system
Gene Names POPTRDRAFT_763057
Protein Names Recommended name: Casparian strip membrane protein POPTRDRAFT_763057
Expression Region 1-199
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Regulates membrane-cell wall junctions and localized cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis that determines an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm and prevents lateral diffusion (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Casparian strip membrane proteins (CASP) family
Database Links

KEGG: pop:POPTR_0006s22510g

STRING: 3694.POPTR_0006s22510.1

Related Products

POPTRDRAFT_763057 Proteins

POPTRDRAFT_763057 Proteins for Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.