Recombinant Potato leafroll virus Protein P1 (ORF1)

Code CSB-CF323521PQW
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P17519
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Potato leafroll virus (strain Potato/Scotland/strain 1/1984) (PLrV)
Sequence STAVKGRVFSDEAVKELEREASEAVKKLARFKSLTDKNWADDYDSDEDYGLEREAATNAP AEKTAQTNSAEKTAPSTSAEKTALTNKPLNGQAAPSAKTNGNSDIPDAATSAPPMDKMVE QIITAMVGRINLSEIEEKIVSRVSQKALQKPKQKKRGRRGGKNKQNSLPPTSTQSTSGAP KKEAAPQASGSAGTSRATTTPAPEAKPSGGKNSAKFTPSWRIKQQDSAGQKPDLKLNSKA
Source in vitro E.coli expression system
Gene Names ORF1
Protein Names Recommended name: Protein P1 Alternative name(s): 69.7 kDa protein Genome-linked protein precursor Protein ORF1 Cleaved into the following 2 chains: 1. Serine protease EC= 2. 3.4.21.- 3. VPg/P1-C25
Expression Region 400-639
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Precursor from which the VPg molecule is probably released at the onset of the RNA synthesis. Essential for virus replication.
Subcellular Location Protein P1: Membrane, Multi-pass membrane protein
Protein Families Peptidase S39B family
Database Links

KEGG: vg:1493894

Related Products

ORF1 Proteins

ORF1 Proteins for Potato leafroll virus (strain Potato/Scotland/strain 1/1984) (PLrV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.