Recombinant Rat ATP-sensitive inward rectifier potassium channel 10 (Kcnj10)

Code CSB-CF012048RAa0
Abbreviation Recombinant Rat Kcnj10 protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Kcnj10
Uniprot No.
Research Area
Neuroscience
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-379aa
Target Protein Sequence
MTSVAKVYYSQTTQTESRPLVAPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVAYHNGKLCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYVADFSLFDQVVKVASPGGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.6 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium. In the kidney, together with KCNJ16, mediates basolateral K(+) recycling in distal tubules; this process is critical for Na(+) reabsorption at the tubules.
Gene References into Functions
  1. H3K9me2 and G9a are sensitive to epileptic seizure activity during the acute phase of epilepsy and can affect the transcriptional regulation of the Kcnj10 (Kir4.1) channel. PMID: 29115470
  2. studies suggest that AGE-modification of laminin is detrimental to Kir4.1 channels. By studying the role of AGEs in Kir4.1 channels we have identified a novel mechanism of Muller cell dysfunction and its subsequent involvement in Diabetic retinopathy. PMID: 29474462
  3. IL-1beta promotes the proliferation of cultured astrocytes by influencing the expression of Kir4.1. PMID: 28395711
  4. Kir4.1 channels possess a diurnal rhythm, and this rhythm is dampened with diabetes, thereby suggesting that the increase in TNF-alpha is detrimental to normal Kir4.1 rhythm and expression. PMID: 28460049
  5. This study demonstrated changes in Kir4.1 expression in an animal model of PTS in the acute and chronic stages of the condition. PMID: 26768400
  6. This study demonstrated that Kir4.1 developmental expression both in the cortex and hippocampus and support the glial role of Kir4.1 in K(+) spatial buffering. PMID: 26427731
  7. data suggest that G83V, L166Q, and Q212R residues play a pivotal role in controlling Kir4.1 channel function. PMID: 26867573
  8. Data suggest that lipopolysaccharide (LPS)-induced downregulation of inwardly rectifying K(+) channel Kir4.1 mRNA in cultured astrocytes might be related with the inflammatory cytokine IL-1beta. PMID: 26927380
  9. Over-activation of NMDA receptors is a primary cause of the reduction of Kir4.1 expression in CNS disorders associated with increased exposure to glutamate. PMID: 25451797
  10. Ependymal cells and tanycytes differentially operate Kir4.1 and AQP4 actively to control the property of fluids at local areas in the brain. PMID: 25380566
  11. This study demonistrated that the epigenetic regulation of Kir4.1, a glial-specific K+ channel, known to be essential for normal CNS development. PMID: 24415225
  12. The present results suggest that reduced activity of astrocytic Kir4.1 channels in the amygdala is involved in limbic hyperexcitability in NERs. PMID: 23603404
  13. Decreased expression of Kir4.1 is observed in the brainstem and cortex from rats in an amyotrophic lateral sclerosis model. PMID: 22987392
  14. An uncoupling expression of AQP4 and Kir4.1 on astrocytic end feet is partly responsible for mediation of cytotoxic edema following subarachnoid hemorrhage. PMID: 22420318
  15. Kir4.1 channels in satellite glial cells are suppressed during trigeminal inflammatory pain. PMID: 21680091
  16. Pigment epithelium-derived factor acts as an antioxidative agent against the decrease in Kir4.1 expression in retinal Muller cells in diabetic conditions. PMID: 22266516
  17. down-regulation of Kir4.1 may mediate distinct aspects of Glutamine-induced astrocytic dysfunction in hepatic encephalopathy. PMID: 21538466
  18. Astrocytes in the CA1 region of the hippocampus are progressively depolarized following cerebral ischemia coinciding with decreased potassium channel Kir4.1 protein expression in glial cells. PMID: 20833221
  19. Heteromeric Kir4.1-Kir5.1 channels confer pH sensitivity to retrotrapezoid nucleus astrocytes. PMID: 20926613
  20. Data show that all Kir4.1 mutations compromised channel function, but the underlying mechanisms were different. PMID: 20807765
  21. CaR decreases cell surface expression of Kir4.1 channels via a mechanism that involves Galpha(q) and caveolin. PMID: 21084311
  22. These results indicate the differential loss of KIR4.1 channel function among SeSAME syndrome mutations. PMID: 20678478
  23. In adult rats, Kir4.1 expression is reduced by nearly 80% following crush spinal cord injury. PMID: 20375134
  24. data suggest the signals on the COOH terminus of Kir4.1 potassium channel determine the intracellular localization of Kir5.1 potassium channel/Kir4.1 heteromer in distal tubules PMID: 15292049
  25. Results demonstrate that variations (T262S and R271C) in the gene encoding Kir4.1 do not produce any observable changes in channel function or in predicted channel structure. PMID: 15936844
  26. disruption of the carboxyl-terminal PDZ-binding motif induced mostly clustered distribution but did not reduce whole-cell channel activity PMID: 16033858
  27. Kir4.1 channels are primarily responsible for significant hyperpolarization of cortical astrocytes and are likely to play a major role in potassium buffering. Significant inhibition of glutamate clearance in astrocytes with knock-down of Kir4.1 occurs. PMID: 17091490
  28. Modulation of the Kcnj10 channel by multiple neuotransmitters via Galphaq-coupled receptors is reported. PMID: 17559083
  29. Regional differences in astrocytic expression of Kir4.1 channels result in marked changes in potassium clearance rates in these two regions of the spinal cord. PMID: 17581847
  30. While confirming similar properties of glial Kir and recombinant Kir4.1, the results also suggest mechanisms underlying K+ buffering in glial cells. PMID: 18293411
  31. These results demonstrate that the phosphorylation-dependent scaffolding of the basolateral K(+) channels by MAGI-1a-long participates in the renal regulation of the fluid and electrolyte homeostasis. PMID: 18303016
  32. Silencing Kir4.1 in the trigeminal ganglion using RNA interference (RNAi) results in a reversible change in nociceptive threshold and nociceptive-related behavior. PMID: 18417695

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein. Basolateral cell membrane.
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ10 subfamily
Tissue Specificity
Predominantly expressed in the brain, including in glial cells of the cerebellum and forebrain. Expressed at lower levels in the kidney, and other peripheral tissues.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*