Recombinant Rat Catechol O-methyltransferase (Comt)

Code CSB-CF005779RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Comt
Uniprot No.
Alternative Names
Comt; Catechol O-methyltransferase
Species
Rattus norvegicus (Rat)
Expression Region
1-264
Target Protein Sequence
MPLAAVSLGLLLLALLLLLRHLGWGLVTIFWFEYVLQPVHNLIMGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
Gene References into Functions
  1. The discovered changes in the expression level of catechol-o-methyltransferase , mineralocorticoid receptor , and b-subunit of epithelial sodium channel confirm their involvement in increased sympathetic stimulation of the of hypertensive rats PMID: 27215035
  2. A higher hepatic COMT activity was found in the mineral water group compared with the tap water and tap-water-plus-NaCl groups. On the other hand, adrenal gland COMT mRNA expression decreased in the MW group compared to TW group. PMID: 25560240
  3. COMT inhibition results in increased pain sensitivity and production of proinflammatory mediators. PMID: 24727346
  4. Our findings suggest that COMT regulates dorsal hippocampal neurochemistry and modulates hippocampus-dependent behaviours. PMID: 22815336
  5. ZNF804a regulates expression of the schizophrenia-associated genes PRSS16, COMT, PDE4B, and DRD2 PMID: 22384243
  6. decreased COMT activity was associated with some changes in feeding microstructure in rats and mice PMID: 21851556
  7. investigation of substrate specificity and metabolite profiles of COMT from liver cytosol; studies include molecular modeling PMID: 22071171
  8. analysis of orientation and cellular distribution of membrane-bound catechol-O-methyltransferase in cortical neurons PMID: 21846718
  9. In rat subarachnoid hemorrhage model could induce the expression of COMT in the rat striatum in the early stage. PMID: 21116937
  10. Reduction of COMT enzyme activity, and thereby possible accumulation of catecholamines, inhibits spinal nociceptive activity and attenuates the expression of spinal LTP. PMID: 20219633
  11. significant effects of hormone replacement and gonadectomy on catechol-O-methyltransferase and monoamine oxidase isoforms in both striatum and cortex PMID: 19909795
  12. These results suggest that the decreased expression of COMT may be an important factor leading to the development of hypertension. PMID: 19966533
  13. Contrary to expectations that COMT would be expressed predominantly in non-neuronal cells, the present study shows that neurons are the main cell populations expressing COMT mRNA in the rat forebrain. PMID: 12535946
  14. liver membrane-bound-catechol-O-methyltransferase may be a relevant factor in blood pressure regulation in rats PMID: 14714585
  15. Strong COMT mRNA expression was observed in the suprachiasmatic nucleus throughout its rostrocaudal extent at postnatal day 1 (P1) and P2, and the mRNA levels decreased gradually until P16. PMID: 15167541
  16. Crystals diffract to 1.6 A resolution on a synchrotron-radiation source and belong to the monoclinic space group P2(1). PMID: 16508109
  17. These data provide the first direct evidence that low COMT activity leads to increased pain sensitivity via a beta(2/3)-adrenergic mechanism. PMID: 17084978
  18. Suppression of catechol-O-methyltransferase activities, decrease in degradation of norepinephrine (NE), and increase in NE release by blunting of alpha(2)-AR function may be involved in salt-sensitive hypertension in Dahl salt-sensitive rats. PMID: 17510509
  19. Catechol-O-methyltransferase activity and protein expression were increased in the substantia nigra after inflammation induced by lipopolysaccharides. PMID: 17573159
  20. Modulation of COMT activity may play a role in the regulation of myometrial contractility and cervical ripening during pregnancy. PMID: 18042640
  21. pI differences distinguishing between the various COMT forms are due to some as yet unidentified structural modification(s) PMID: 18831714
  22. This work reports the first crystallographic study of Rat COMT complexed with non-nitrocatechol inhibitor. PMID: 19056347
  23. The crystal structures of the Apo and Holo form of rat catechol-O-methyltransferase were determined and compared. PMID: 19111934

Show More

Hide All

Subcellular Location
[Isoform Soluble]: Cytoplasm.; [Isoform Membrane-bound]: Cell membrane; Single-pass type II membrane protein; Extracellular side.
Protein Families
Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family
Database Links

KEGG: rno:24267

STRING: 10116.ENSRNOP00000043148

UniGene: Rn.220

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1