Recombinant Rat Cholecystokinin receptor type A (Cckar)

Code CSB-CF004772RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Cckar; Cholecystokinin receptor type A; CCK-A receptor; CCK-AR; Cholecystokinin-1 receptor; CCK1-R
Species
Rattus norvegicus (Rat)
Expression Region
1-444
Target Protein Sequence
MSHSPARQHLVESSRMDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSALQI LLYSIIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLK DFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICRPLQSRVWQTKSHALKVIAAT WCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPSDAMQQSWQTFLLLILFLLPGIVM VVAYGLISLELYQGIKFDASQKKSAKEKKPSTGSSTRYEDSDGCYLQKSRPPRKLELQQL SSGSGGSRLNRIRSSSSAANLIAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAE KHLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGVRGEVGEEE DGRTIRALLSRYSYSHMSTSAPPP
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for cholecystokinin. Mediates pancreatic growth and enzyme secretion, smooth muscle contraction of the gall bladder and stomach. Has a 1000-fold higher affinity for CCK rather than for gastrin. It modulates feeding and dopamine-induced behavior in the central and peripheral nervous system. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. This study demonistrated that Cckar and Melanin-concentrating hormone colization in neuron in the lateral hypothalamus (LH) and zona incerta (ZI), but MCHR1 mRNA is widely expressed throughout the brain. PMID: 24978951
  2. Data suggest that Apo AIV (apolipoprotein AIV) in NTS (nucleus of the solitary tract) or/and peripheral Cck (cholecystokinin) require vagal Cck1r/Cckar signaling to elicit satiation; high-fat diet reduces satiating capacity of these signals. PMID: 24564397
  3. factors secondary to obesity and/or diabetes rather than impaired CCK-1 receptor signaling may contribute to altered CART expression PMID: 23545074
  4. CCK-A receptors are located on the cell bodies of cholinergic interneurons in the corpus striatum. PMID: 22981453
  5. Activation of duodenal PKC-delta leads to the stimulation of CCK release and activation of the CCK-A receptor signaling axis to lower glucose production in normal rats. PMID: 21984583
  6. Data indicate that the Homo-Phe derivative 2 (VL-0797) enhanced 12-fold the affinity for the rat CCK(1)-R affinity and 15-fold for the human CCK(1)-R relative to the reference compound 12 (VL-0395). PMID: 21728335
  7. Data suggest L-364,718 potentiates electroacupuncture analgesia through the CCK-A receptor of pain-excited and pain-inhibited neurons in the nucleus parafascicularis. PMID: 20953702
  8. CCK1 and CCK2 receptors are expressed on pancreatic stellate cells and induce collagen production PMID: 20843811
  9. our results demonstrate for the first time, that CCK-1 receptor plays a crucial role in both meal-induced and fasting insulin sensitization PMID: 20624386
  10. Present study examined the contribution of genetics, sex and early maternal environment to anxiety-like behaviors and locomotion in CCK1 knockout rats, suggesting that the mutation may predispose (rather than induce) the animals to an anxious phenotype. PMID: 20347877
  11. The results of this study showed that increased oil intake in cck-1 receptor deficient rats is driven by both peripheral deficits to satiation and altered orosensory sensitivity. PMID: 19887078
  12. Gastric leptin may exert acute sympathoinhibitory and cardiovascular effects via vagal transmission and CCK(1) receptor activation and may play a separate role to adipose leptin in short-term cardiovascular regulation. PMID: 19940076
  13. Activation of high-affinity CCK(A) receptors elicits Ca(2+) oscillations, whereas stimulation of low-affinity CCK(A) receptors evokes a sustained Ca(2+) plateau; these modes are mediated through L-type Ca(2+) channel and involve G(q) protein. PMID: 12016125
  14. These results indicate that CCKB, but not CCKA receptors are involved in anxiety, as tested by microinjection of cholecystokinin agonists. PMID: 12373548
  15. endogenous CCK appears to act in part by a paracrine or neurocrine mechanism at CCKARs peripheral to the blood-brain barrier to inhibit gastric emptying PMID: 12388446
  16. Endogenous CCK appears to act in part at CCKARs peripheral to the blood-brain barrier to inhibit food intake PMID: 12414437
  17. None of the three known phases of the febrile response of rats to lipopolysaccharides requires the CCK-A receptor. PMID: 12562931
  18. results demonstrate that cholecystokinin stimulates tyrosine phosphorylation of three sites in focal adhesion kinase and proline-rich kinase 2 but differs in participation of cholecystokinin receptor A and by protein kinase C and [Ca2+] PMID: 12651850
  19. CCK-AR and CCK-BR gene were present in pulmonary vascular endothelial cells, macrophages, bronchial epithelial cells and alveolar epithelial cells, which play an important role in mediating the regulatory actions of CCK-8 on these cells. PMID: 12800239
  20. peripheral and central responses to enterostatin are mediated through or dependent on peripheral and central CCK-A receptors PMID: 12855414
  21. CCK-A receptors play an important role in the regulation of central dopamine transmission, as revealed by studies of the CCK-A receptor-deficient Otsuka Long Evans Tokushima Fatty (OTLEF) rat strain. PMID: 12932815
  22. spatial memory was impaired in the OLETF rats with genetic abnormality in cck-a receptor PMID: 14607104
  23. the data identified CCK-A and CCK-B receptor mRNAs in the rat retina and demonstrated that they are functional, stimulating tyrosine phosphorylation pathways. PMID: 14698681
  24. involvement of type A CCK receptors in the mediation of the inhibitory effect of large doses of ethanol on the gastric emptying PMID: 14700745
  25. acute pancreatitis induced by bile-pancreatic duct ligation associates with a temporal increase in pancreatic cholecystokinin-A receptor protein expression, p38 mitogen activated protein kinase activation, and nuclear factor-kappaB activation PMID: 14988658
  26. apo A-IV released from the intestinal mucosa during lipid absorption stimulates the release of endogenous CCK that activates CCK(1) receptors on vagal afferent nerve terminals initiating feedback inhibition of gastric motility. PMID: 15117731
  27. Differential roles for cholecystokinin a receptors in energy balance in rats and mice. PMID: 15123537
  28. The OLETF rats showed a large hysteresis. PMID: 15178543
  29. Taste preference in Otsuka Long-Evans Tokushima fatty (OLETF) rats with deficiency of this receptor. PMID: 15358606
  30. These findings demonstrate that compared with controls, OLETF rats differ in their gustatory functions with an overall augmented sensitivity for sweet that progresses during prediabetes. PMID: 16081877
  31. Lack of CCK-1 receptors, or other OLETF-related abnormalities, resulted in a satiation deficit, leading to increased meal size, hyperphagia, and increased weight gain as early as 2-4 postnatal days. PMID: 16099824
  32. Cholecystokinin-8 activates the brainstem and myenteric neurons through the CCK1 receptor. PMID: 16112401
  33. CCK1 receptors have a role in stress and pain responses in rats PMID: 16289472
  34. under 'basal' conditions, a portion of the glandular protein synthesis, as well as the whole increase in synthesis in response to administration of pentagastrin, engaged both types of CCK receptors. PMID: 16556659
  35. OLETF rats do not express deficits in controlling gastric emptying rates; however, they exhibit decreased behavioral and vagal responsiveness to gastric distension that may contribute to the increased meal size in these animals. PMID: 16728725
  36. REVIEW: hyperphagia and obesity in OLETF rats without CCK-1 receptors PMID: 16815799
  37. Report effects of cholecystokinin-58 on type 1 cholecystokinin receptor function and regulation. PMID: 18776046
  38. cholecystokinin CCK1 and serotonin 5-HT3 receptors are mediators of the excitatory effects of cholecystokinin and 5-HT, respectively, on pancreatic vagal afferent discharge PMID: 19026634
  39. Fischer 344 rats lacking the cholecystokinin-1 receptor gene show normal feeding and body weight. PMID: 19111529
  40. The findings suggest that in addition to previously described deficits in peripheral satiety signals and augmented orexigenic regulation, the anorectic effect of CART peptide may also be diminished in CCK-1 deficient rats. PMID: 19533109
  41. endogenous CCK-1 receptor signaling in infants is a potential pathway through which maternal-pup interactions regulate the development and functional organization of emotional circuits that control anxiety-like behavior in the offspring. PMID: 20001102

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Pancreas and brain. Also expressed in the gastrointestinal system and vagus nerve.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1