Recombinant Rat NADPH oxidase 1 (Nox1)

Code CSB-CF015959RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Nox1; Mox1; Noh1; NADPH oxidase 1; NOX-1; Mitogenic oxidase 1; MOX-1; NADH/NADPH mitogenic oxidase subunit P65-MOX; NOH-1
Species
Rattus norvegicus (Rat)
Expression Region
1-563
Target Protein Sequence
MGNWLVNHWLSVLFLVSWLGLNIFLFVYVFLNYEKSDKYYYTREILGTALALARASALCL NFNSMVILIPVCRNLLSFLRGTCSFCNHTLRKPLDHNLTFHKLVAYMICIFTAIHIIAHL FNFERYSRSQQAMDGSLASVLSSLFHPEKEDSWLNPIQSPNVTVMYAAFTSIAGLTGVVA TVALVLMVTSAMEFIRRNYFELFWYTHHLFIIYIICLGIHGLGGIVRGQTEESMSESHPR NCSYSFHEWDKYERSCRSPHFVGQPPESWKWILAPIAFYIFERILRFYRSRQKVVITKVV MHPCKVLELQMRKRGFTMGIGQYIFVNCPSISFLEWHPFTLTSAPEEEFFSIHIRAAGDW TENLIRTFEQQHSPMPRIEVDGPFGTVSEDVFQYEVAVLVGAGIGVTPFASFLKSIWYKF QRAHNKLKTQKIYFYWICRETGAFAWFNNLLNSLEQEMDELGKPDFLNYRLFLTGWDSNI AGHAALNFDRATDVLTGLKQKTSFGRPMWDNEFSRIATAHPKSVVGVFLCGPPTLAKSLR KCCRRYSSLDPRKVQFYFNKETF
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Pyridine nucleotide-dependent oxidoreductase that generates superoxide and might conduct H(+) ions as part of its electron transport mechanism.
Gene References into Functions
  1. Nox1 was able to increase SOD activity, thereby demonstrating its positive effect on the proliferation of MCTPASMCs. PMID: 28849167
  2. these data demonstrate that altered zinc distribution leading to accumulation of zinc in the mitochondria increases mitochondrial ROS production causing NF-kappaB activation which in turn upregulates Nox1 expression inducing senescence of vascular smooth muscle cells PMID: 28363602
  3. Curcumin attenuated liver damage through the downregulation of Rac1, Rac1-GTP, and NOX1 as well as reduced oxidative stress in the serum and liver tissue of biliary duct-ligated rats. PMID: 28336111
  4. Studied the physiology of advanced oxidation protein products (AOPPs) in beta-cell destruction and dysfunction. Found exposure of cells to AOPPs induced an increase in Bax expression, caspase-3 activity, and apoptosis as well as a decrease in Bcl-2 expression. AOPP challenge rapidly increased the production of intracellular superoxide by activation of NADPH oxidases. PMID: 28263293
  5. Quercetin demonstrated hepatoprotective activity against BDL-induced liver injury through increasing antioxidant capacity of the liver tissue, while preventing the production of Rac1, and NOX1. PMID: 28119263
  6. NOX1 may be a critical effector of cardiovascular toxicity caused by smoking. PMID: 27816504
  7. Non-muscle myosin regulatory light chain (nmMLC20) could promote the senescence and dysfunctions of endothelial progenitor cells in pulmonary artery hypertension through up-regulation of NOX in a phosphorylation-dependent manner PMID: 26872992
  8. NOX1 involvement in aASC cytostasis was reaffirmed when cells that were expanded under normoxic conditions in the presence of a specific NOX1 inhibitor, ML171, demonstrated reduced ROS accumulation, reduced apoptosis and long-term expansion. PMID: 25880095
  9. Urotensin II-increased reactive oxygen species production via the NADPH oxidase pathway is partially associated with activation of the PI3K/Akt and ERK cascades PMID: 26658815
  10. Our data suggested that antihypertensive mechanisms of arctigenin were associated with enhanced eNOS phosphorylation and decreased NADPH oxidase-mediated superoxide anion generation. PMID: 26585490
  11. Activation of the NOX system and subsequent production of ROS are likely responsible for the downregulation of renal tubular Na/K-ATPase expression in early unilateral ureteral obstruction PMID: 25997532
  12. The activities of pentose phosphate pathway enzymes, NADPH oxidase (Nox), were measured, in brain of neonate rats subjected to a streptozotocin-induced neonatal hyperglycemia. PMID: 25682169
  13. Established are novel molecular mechanisms underlying oxidative stress-mediated dopaminergic neuronal death in which MMP3 activation is a key upstream event that leads to Nox1 induction and eventual dopaminergic neuronal death. PMID: 25536219
  14. messenger RNA expressions and protein levels of NADPH oxidase subunits were markedly reduced after IMP treated in SHR. PMID: 24973900
  15. Cyclic stretch initiates a signal through MEF2B that potentiates Nox1-mediated ROS production and causes VSMC to switch to a synthetic phenotype. PMID: 25550204
  16. This evidence implies that Nox1-mediated oxidative stress plays an important role in neuronal cell death and cognitive dysfunction in VaD. Nox1 may serve as a potential therapeutic target for VaD. PMID: 24294978
  17. In conclusion, B. trimera extracts exert antioxidant properties by scavenging ROS and decrease the expression of genes responsible by reactive species production in neutrophils. PMID: 24372242
  18. These results demonstrate that PKCdelta, NADPH oxidase, and oxidative stress play a causal role in FFA-induced hepatic insulin resistance. PMID: 24824652
  19. Nox1 mediates H2O2-induced ARPC2 expression. PMID: 24152438
  20. Upregulation of NOX-1 was found to be involved in cisplatin-induced nephrotoxicity. PMID: 24211271
  21. Suggest a critical role for NOX1 in the onset of spontaneous pulmonary arterial hypertension by regulating Kv1.5 and intracellular potassium levels. PMID: 24233492
  22. In dopaminergic neurons exposed to paraquat, protein kinase C(PKC)delta can regulate Nox1 expression. PMID: 23827392
  23. The expression of NOX1 was upregulated after IL-4 treatment for 4 h, but it was downregulated after 8-24 h. It was suppressesd by amyloid beta or dbcAMP. PMID: 22565378
  24. NADPH oxidase plays a key role in fructose-induced hepatic oxidative stress production and the mechanism of liver steatosis, suggesting its potential usefulness for the prevention/treatment of Type 2 diabetes mellitus. PMID: 22738259
  25. dopaminergic neurons are equipped with the Nox1/Rac1 superoxide-generating system. Stress-induced Nox1/Rac1 activation causes oxidative DNA damage and neurodegeneration. PMID: 22098189
  26. Both ET-1 activation of ET(A)/NADPH oxidase pathway and diminished antioxidants critically contribute to epithelial progenitor cells reduction and dysfunction via increased oxidative stress in salt-sensitive hypertension. PMID: 22431579
  27. NADPH oxidase and PKC contribute to increased Na transport by the thick ascending limb during type 1 diabetes. PMID: 22203737
  28. NOX is the main cellular source of the reactive oxygen species generated by hepatic stellate cells in response to leptin stimulation. PMID: 21138635
  29. Overtraining can activate the NADPH oxidase-mediated overproduction of ROS, leading to increased lipid peroxidation. PMID: 21814483
  30. An increase of NADPH oxidase-1 in hippocampus follows anxiety-like behavior and adjuvant arthritis. PMID: 20970480
  31. investigated roles and signal pathways of Nox1 expression involved in hypertrophy of vascular smooth muscle cells induced by aldosterone and revealed that activation of tyrosine kinase Src-ATF1 cascade was essential for aldosterone-Nox1 interactions PMID: 21505267
  32. NADPH oxidase-dependent formation of reactive oxygen species mediates angiotensin II dependent epithelial-mesenchymal transition and accumulation of extracellular matrix in rat peritoneal mesothelial cells. PMID: 21537828
  33. Reactive oxygen species generated by flavoprotein NADPH oxidase may be involved in neuronal death in the pilocarpine model of epilepsy. PMID: 20732386
  34. Expression of Nox1 was increased in vascular smooth muscle cells from SHR. Nox1 regulation by Angiotensin II,but not Endothelin-1,is important in *O(2)(-) formation in VSMCs from SHR. PMID: 21419746
  35. High NOX1 expression is associated with colon cancers. PMID: 20715105
  36. NAD(P)H oxidase is an important source of superoxide in pancreatic islets and the activity of NAD(P)H oxidase is involved in the control of insulin secretion by palmitate. PMID: 20857410
  37. Rac1 induced NADPH oxidase activation, ROS generation and oxidative stress in the hippocampal CA1 region after cerebral ischemia. PMID: 20830300
  38. Rac1-mediated regulation of phagocyte-like NADPH oxidase contributes to cytokine-mediated mitochondrial dysfunction in the beta-cell. PMID: 20943855
  39. NOX1 might control autocrine cell growth of liver tumor cells through regulation of the EGFR pathway PMID: 20525691
  40. NADPH oxidase up-expression is closely associated with hypertension in rats exposed to chronic intermittent hypoxia. PMID: 19134410
  41. Ang II stimulates TAL O2 production via activation of AT(1) receptors and PKC(alpha)-dependent NADPH oxidase PMID: 20448043
  42. Data report that the cell invasion activity was augmented in K-Ras-transformed normal rat kidney cells and attenuated by transfection of Nox1 small interference RNAs (siRNAs) into the cells. PMID: 20018867
  43. The presence of a O(2)(-*)-generating enzyme in close vicinity to the sites of neurotransmitter handling in the nerve fibers suggests the possibility of novel redox-mediated mechanisms in peripheral neurovascular control. PMID: 19716351
  44. increased HO-1 expression and CO decreases platelet-derived growth factor-stimulated VSMC migration via inhibition of Nox1 enzymatic activity PMID: 19875720
  45. Nox1 co-localizes with caveolin in punctate patches on the surface & along the cellular margins of vascular smooth muscle cells. Its role may be correlated with its compartamentalization in specific membrane signaling domains. PMID: 14670934
  46. NAD(P)H oxidase activity is inhibited by HO-1 by down-regulating cytochrome b558 expression via the reduction of heme availability PMID: 15123630
  47. transactivation of the EGF receptor and the activation of ERK1/2, PI3 kinase, and ATF-1 constitute the signaling pathways involved in the upregulation of NOX1 PMID: 15710429
  48. iotensin II-related increased expression of NAD(P)H oxidase may play an important role in increased oxidative stress in islets of Type 2 diabetes PMID: 15922295
  49. NADPH oxidase may mediate ROS-induced apoptosis in pancreatic acinar cells in a Ca(2+)-dependent manner PMID: 16085178
  50. nos2 expression is downregulated by bilirubin via inhibition of NAD(P)H oxidase PMID: 16129699

Show More

Hide All

Subcellular Location
Cell projection, invadopodium membrane; Multi-pass membrane protein. Cell membrane.
Tissue Specificity
Expressed in vascular smooth muscle cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1