Product Details

Target Names

Olr1

Uniprot No.

Alternative Names

Olr1; Lox1; Oldlr1; Oxidized low-density lipoprotein receptor 1; Ox-LDL receptor 1; Lectin-like oxidized LDL receptor 1; LOX-1; Lectin-like oxLDL receptor 1; Lectin-type oxidized LDL receptor 1

Species

Rattus norvegicus (Rat)

Expression Region

1-364

Target Protein Sequence

MAFDDKMKPVNGQPDQKSCGKKPKGLHLLSSTWWCPAAVTLAILCLVLSVTLIVQQTQLLQVSDLLKQYQANLTQQDHILEGQMSAQKKAENASQESKRELKEQIDTLTWKLNEKSKEQEKLLQQNQNLQEALQRAVNASEESKWELKEQIDILNWKLNGISKEQKELLQQNQNLQEALQKAEKYSEESQRELKEQIDTLSWKLNEKSKEQEELLQQNQNLQEALQRAANSSGPCPQDWIWHKENCYLFHGPFNWEKSRENCLSLDAQLLQISTTDDLNFVLQATSHSTSPFWMGLHRKNPNHPWLWENGSPLSFQFFRTRGVSLQMYSSGTCAYIQGGVVFAENCILTAFSICQKKANLLLTQ

Protein Length

full length protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Target Background

Function

Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro-oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro-atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram-positive bacteria.

Gene References into Functions

an important role of LOX-1 in the maintenance of PASMCs phenotype. PMID: 29069578
data support an important role for STBEVs in impairment of vascular function via activation of LOX-1 and reduced nitric oxide mediated vasodilation. Moreover, we postulate that the LOX-1 pathway could be a potential therapeutic target in pathologies associated with vascular dysfunction during pregnancy PMID: 28672042
Negative feedback regulation between let-7g and LOX-1 mediated hypoxia-induced proliferation of in pulmonary artery smooth muscle cells (PASMCs). PMID: 28108289
LOX-1 promotes right ventricular hypertrophy in hypoxia-exposed rats PMID: 28259654
Losartan attenuated lung injury by suppressing LOX-1 expression to alleviate inflammation and cell apoptosis. PMID: 26884836
Swimming exercise reduced heart expression of LOX-1 receptor and free radical production in experimental diabetes. PMID: 26432573
OLR1 is a novel molecular link between the proliferative and inflammatory responses of vascular smooth muscle cells. PMID: 26305474
data indicated that olmesartan may attenuate the impairment of endothelial cell via down-regulation of the increased LOX-1 expression induced by ox-LDL. PMID: 22408405
EETs exert beneficial effects on ox-LDL-induced inflammation primarily through the inhibition of LOX-1 receptor upregulation, MAPK phosphorylation, and NF-kappaB activation and through the upregulation of CYP2J4 expression. PMID: 24486707
LOX-1 is a promising therapeutic target in neonatal HIE, and the inhibition of LOX-1 may become a novel treatment for babies who have experienced asphyxia. PMID: 24731447
results indicate that LOX-1 is essential in microglia for promoting an inflammatory response in the presence of soluble neuronal-injury signals such as extracellular HSP60, thereby linking neuroinflammation and neurotoxicity PMID: 22847064
LOX-1 activation by oxLDL and subsequent peroxynitrite generation as a novel mechanism by which disruption of the BBB occurs in EPE. PMID: 23230281
These findings indicated that LOX-1 expression was up-regulated in the cortex of SHR and its expression has implication in neuronal apoptosis. PMID: 22885180
In a rat model of preeclampsia, there is dramatic increase in expression levels of both LOX-1 receptor and endothelial NO synthase enzyme, along with increased superoxide production and modestly decreased endothelial function. PMID: 22392901
Inhibition of rat LOX-1 receptor reduces leukocyte adhesion in experimental endotoxemia. PMID: 21143965
Data show that a high fat diet elevates LOX-1 protein and mRNA expression in aorta, and that sleeve gastrectomy decreases plasma LDL levels, and downregulates LOX-1 protein and mRNA expression. PMID: 21990956
LOX-1 appears to be involved in CRP-induced complement activation, and thus may serve to locate the site of CRP-induced complement activation and inflammation. PMID: 21821723
enhanced expression and activation of LOX-1 mediated the enhancement of vascular permeability, which contributed to the vascular lipid accumulation under hypertensive states PMID: 20216085
expression pattern of LOX1-R in brain microvessels endothelial cells and its modulation by astrocytes PMID: 12095612
findings indicate that myocardial ischemia-reperfusion upregulates LOX-1 expression, which through p38 MAPK activation increases the expression of MMP-1 and adhesion molecules PMID: 12384456
LOX-1 may have a role in the pathogenesis of osteoarthritis, inducing chondrocyte death through PI3 kinase/Akt pathway. PMID: 12435393
LOX-1 is an adhesion molecule involved in leukocyte recruitment and may represent an attractive target for modulation of endotoxin-induced inflammation PMID: 12538855
enhanced renal expression of olr1 might play some roles in the progression of chronic renal failure in rats. PMID: 12661921
LOX-1 up-regulation is redox-sensitive PMID: 16055083
the bradykinin-eNOS and oxidative stress-LOX-1 pathway have roles in cardiovascular remodeling under chronic angiotensin-converting enzyme inhibition PMID: 16214149
LOX-1 activation driven by lipid oxidants in the preurine fluid is critical in inflammatory changes PMID: 18322020
Oxidized low-density lipoprotein induces matrix metalloproteinase-9 expression at transcriptional and translational level in brain astrocytes, which are mediated through mitogen-activated protein kinase signaling pathways leading to AP-1 activation. PMID: 18661553

Hide All

Subcellular Location

Cell membrane; Lipid-anchor. Cell membrane; Single-pass type II membrane protein. Membrane raft. Secreted.

Tissue Specificity

Predominantly expressed in lung and at lower level in kidney. Expressed in macrophages but not in vascular smooth muscle cells.

Database Links

KEGG: rno:140914

STRING: 10116.ENSRNOP00000011196

UniGene: Rn.87449

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-CF016331RA
MSDS	MSDS
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Oxidized low-density lipoprotein receptor 1 (Olr1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage