Recombinant Rhodospirillum rubrum UPF0761 membrane protein Rru_A2625(Rru_A2625)

Code CSB-CF647788RMB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q2RR23
Storage Buffer Tris-based buffer,50% glycerol
Species Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)
Sequence MVDDENRRRGLLGRRSHARSWLPVKPRRILATAGSFTILVLRALITHDIPRLAASLAYTS LLALVPLIAIALAILAAFPGFGDERERMVAWIIETFVPYRRTEILDQVEHFVGAAAGLTA LGVAGLTLTAIILLLTIESSLNAIFRVEKSRHPLARLLVYWSVLTGGPLLMGLSFSLSSY LVAIRHLVGTDVMSPFDALTPTLGPPLLSLTAMTLLYMLVPNRPVPLFHALAGALVATLA SALLRSAFLMVITRGLSYETLYGALAALPAFLVWMYLSWAVVLMGAVTAAEIPNWKMARR LTRAGQDERAARLRIAVEIMVAAARAYGEGQGDGASRRALSALTATPDRRQAGVLRDLDK AGLLIRDEDGAVLPGRDPRRITLAEILHALTLAPPTGTVGGPGWPDLLRHALETAGGDYD RALGLSLDALVQAEPLGARI
Source in vitro E.coli expression system
Gene Names Rru_A2625
Protein Names Recommended name: UPF0761 membrane protein Rru_A2625
Expression Region 1-440
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0761 family
Database Links

KEGG: rru:Rru_A2625

STRING: 269796.Rru_A2625

Related Products

Rru_A2625 Proteins

Rru_A2625 Proteins for Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.