Recombinant Xenopus laevis Protein wntless homolog B(wls-b)

Code CSB-CF688875XBE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5FWK6
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Xenopus laevis (African clawed frog)
Sequence FLVGGLIAPKPTTYVNPVAMKCIDVRKSHRSSKWLMPWGTEPCKSIQSFDEAANRLIEAN DIVFAAHIPNSQFEMSPWFQFMLVVLQLDIAFKLNNYIEDHSMVTLDVAVAYRDDLKEEW KELARSVEQRKLNCILPVDKTVANEGRHYDCDVIPLMELGSVSHKYYLFNIRLPVNERQK MNIGIGEIRDMHVVSIFQNGGFTMVWFAMKTFLTPCIIIIMIWYWRRITMMTRSPVLLEK VIFALGISMTFINIPVEWFSIGYDWTWMLLFGDIRQGIFYAMLLSFWIIFCGEHMMDQAE RNRISIYWKQVGPIAFGSCCLFIFDMCERGVQLKNPFYSIWTTDVGAEIAMAFIIVAGIC ACLYFLFLCFMVYQVFRNISGKRSNLPAMSKARRLHYEGLIFRFKFLMIITLACAALTVV FFITTQITEGNWKLGDLSIELNSAFFTGIYGMWNLYVFALMFLYAPSHKHYGDGQSNDGA GMSSGEELQLTTTITHIDGPTELYRLAGKEAQE
Source in vitro E.coli expression system
Gene Names wls-b
Protein Names Recommended name: Protein wntless homolog B Short name= XWntless Alternative name(s): Integral membrane protein GPR177-B
Expression Region 29-541
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for a subset of Wnt-dependent developmental processes, in particular, eye and pronephros development. Regulates the secretion of wnt4, which is required for eye development.
Subcellular Location Golgi apparatus membrane, Multi-pass membrane protein, Cytoplasmic vesicle membrane, Multi-pass membrane protein
Protein Families Wntless family
Tissue Specificity Enriched in the animal hemisphere of the early cleavage embryo, where expression persists until the late gastrula stage. At the neurula stage, strongly expressed at the border of the neural plate and dorsal midline. After the neurula stage, expressed in v
Database Links

KEGG: xla:735023

UniGene: Xl.70714

Related Products

wls-b Proteins

wls-b Proteins for Xenopus laevis (African clawed frog)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.