Recombinant Human Fibroblast growth factor 8 (FGF8) (Active)

In Stock
Code CSB-AP004031HU
Abbreviation Recombinant Human FGF8 protein (Active)
MSDS
Size $204
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 21.87 ng/ml.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
AIGF; Androgen induced growth factor; Androgen-induced growth factor; FGF 8; FGF-8; FGF-8b; FGF8; FGF8_HUMAN; Fibroblast growth factor 8 (androgen induced); Fibroblast growth factor 8; Fibroblast growth factor 8 precursor; HBGF 8; HBGF-8; HBGF8; Heparin-binding growth factor 8; HH6; KAL6
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
23-215aa
Complete Sequence
QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Mol. Weight
22.5 kDa
Protein Length
Full Length of Mature Protein of Isoform FGF-8B
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20mM PB,300mM NaCl,2% Sucrose,0.02% Tween 80,pH7.4.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Fibroblast Growth Factor 8 (FGF8) is produced in an E. coli expression system and spans the full mature protein length of Isoform FGF-8B, specifically amino acids 23-215. This tag-free protein shows a purity level exceeding 95%, as verified by SDS-PAGE analysis. The protein demonstrates biological activity with an ED50 of 21.87 ng/ml in a cell proliferation assay using BALB/c 3T3 cells. Endotoxin levels remain below 1.0 EU/µg, determined by the LAL method.

Fibroblast Growth Factor 8 (FGF8) belongs to the fibroblast growth factor family and appears to play a critical role in embryonic development and cell growth. It participates in several signaling pathways that influence cell division, differentiation, and survival. FGF8's research value likely stems from its involvement in various developmental processes, which makes it a useful tool for studying cellular growth mechanisms and developmental biology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Cell Proliferation and Growth Factor Signaling Studies

This recombinant FGF8 protein can be applied to investigate fibroblast growth factor signaling pathways in various cell culture systems. The confirmed biological activity with an ED50 of 21.87 ng/ml in BALB/c 3T3 cells offers a reliable reference point for dose-response experiments. Scientists can apply this protein to study downstream signaling cascades, receptor binding kinetics, and cellular responses to FGF8 stimulation in controlled in vitro environments.

2. Developmental Biology Research

FGF8 plays crucial roles in embryonic development, which may make this recombinant protein valuable for studying developmental processes in model systems. The protein can be added to organoid cultures, tissue explants, or primary cell cultures to investigate morphogenetic processes and cell fate determination. High purity (>95%) and low endotoxin levels suggest it should work well for sensitive developmental assays where contamination could muddy the results.

3. Receptor Binding and Interaction Studies

The tag-free nature of this recombinant FGF8 makes it potentially ideal for studying protein-protein interactions and receptor binding without interference from fusion tags. Scientists can use this protein in surface plasmon resonance, isothermal titration calorimetry, or other biophysical techniques to characterize FGF receptor binding affinities and kinetics. It may also work in competitive binding assays to evaluate the specificity of FGF8-receptor interactions.

4. Antibody Development and Validation

This highly pure recombinant FGF8 protein serves as a promising antigen for generating and validating antibodies against human FGF8. The protein can be used for immunizing animals, screening hybridomas, and validating antibody specificity through ELISA, Western blotting, or immunoprecipitation assays. The confirmed biological activity suggests that antibodies developed against this protein should recognize the native, functional form of FGF8.

5. Biochemical Characterization and Protein Stability Studies

Scientists can apply the recombinant FGF8 protein for comprehensive biochemical analyses including protein folding studies, thermal stability assessments, and structure-function relationship investigations. Researchers can examine the protein's behavior under various buffer conditions, pH ranges, and temperatures to optimize storage and experimental conditions. The high purity level should allow for accurate spectroscopic and analytical measurements for detailed protein characterization.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*