Recombinant Mouse Platelet-derived growth factor subunit B(Pdgfb)

In Stock
Code CSB-AP004141MO
Product Type Growth Factor
Size US$137
Uniprot No. P31240
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm Filtered 4 mM HCl
Alias Platelet-Derived Growth Factor Subunit B; PDGF Subunit B; PDGF-2; Platelet-Derived Growth Factor B Chain; Platelet-Derived Growth Factor Beta Polypeptide; Proto-Oncogene c-Sis; Becaplermin; PDGFB; PDGF2; SIS
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 40 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
Research Area Cancer
Source E.coli
Gene Names Pdgfb
Expression Region 82-190aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 13.4 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.
Subcellular Location Secreted
Protein Families PDGF/VEGF growth factor family
Tissue Specificity Localized to vascular smooth muscle cells. Also weakly expressed by cortical interstitial cells but absent in tubules. Up-regulated in areas of renal fibrosis. In mice with unilateral ureteral obstruction, an increased expression in interstitial cells and
Database Links

KEGG: mmu:18591

STRING: 10090.ENSMUSP00000000500

UniGene: Mm.144089

Pathway Jak-STAT signaling pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Ras signaling pathway
Phospholipase D signaling pathway
Rap1 signaling pathway

Related Products

Pdgfb Proteins

Pdgfb Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.