Name: Recombinant Mouse Interleukin-15 receptor subunit alpha(Il15ra),partial (Active)
Brand: CUSABIO
SKU: CSB-AP004801MO

Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL?2 mouse cytotoxic T cells is less than 10 ng/ml.
Target Names	Il15ra
Uniprot No.	Q60819
Research Area	Immunology
Alternative Names	Il15ra; Interleukin-15 receptor subunit alpha; IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; CD antigen CD215) [Cleaved into: Soluble interleukin-15 receptor subunit alpha; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA)]
Species	Mus musculus (Mouse)
Source	Mammalian cell
Expression Region	33-205aa
Complete Sequence	GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK
Mol. Weight	45.5 kDa
Protein Length	Partial
Tag Info	C-terminal hFc-tagged
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Background

Function (From Uniprot)	High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. In neutrophils, binds and activates kinase SYK in response to IL15 stimulation. In neutrophils, required for IL15-induced phagocytosis in a SYK-dependent manner.
Gene References into Functions	these data support that IL15RA plays a cell-autonomous role in osteoblast function and bone mineralization PMID: 28602725 These data provide additional evidence to implicate IL-15Ralpha as a regulator of skeletal muscle phenotypes through effects on the mitochondrion, and suggest these effects are driven by alterations to the mitochondrial proteome. PMID: 26458787 Spontaneous cage activity was not different and IL-15 protein levels were lower in male and female mIl15ra(fl/fl)/Cre(+) mice. PMID: 25505029 Despite being protected against diet induced obesity, IL-15R alpha knockout mice are hyperglycemic and insulin-resistant. PMID: 26269523 Signaling through IL-15Ralpha regulates the development of gammadelta-17 cells early in ontogeny. PMID: 26195801 lower frequencies of IL-15Ralpha expression in PBMCs of Behcet's disease-like symptomatic mice PMID: 23618691 Epidermal IL-15Ralpha acts as an endogenous antagonist of psoriasiform inflammation in mouse and man. PMID: 24019554 a greater mitochondrial density and mitochondrial DNA content was found in fast muscles from IL-15-Receptor-alpha KO mice that was not due to the presence of smaller muscle fibers. PMID: 23116661 IL-15 is produced and secreted only as a heterodimer with IL-15Ralpha. PMID: 22496150 Stage 3 thymic invariant natural killer NKT cells are specifically reduced in IL-15Ralpha-deficient mice, whereas the acquisition of natural killer (NK) receptors occurs at stage 3 IL15-dependent thymic cell development. PMID: 21709149 Different levels of IL-15 trans-presentation are required for different natural killer (NK) cell developmental events to reach full maturation status PMID: 21715685 IL-15 receptor alpha has a role in endurance, fatigability, and metabolic characteristics of mouse fast skeletal muscles PMID: 21765213 The disrupted circadian rhythm of temperature and activity in the IL15Ralpha KO mice after LPS suggests that upregulated IL15 receptors may serve a beneficial role to counteract the consequences of neuroinflammation. PMID: 20981579 IL15 is essential to maintain neurochemical homeostasis and thereby plays a role in preventing neuropsychiatric symptoms. PMID: 20724079 IL15Ralpha is co-localized with co-receptor IL2Rgamma and IL-15 in neuroinflamed cerebral endothelia. PMID: 21155807 IL15Ralpha is essential for normal anxiety-like behavior, but inhibition of gliosis in the fearless IL15Ralpha knockout mice or IL15 treatment of normal mice did not acutely modulate behavioral performance as tested PMID: 20600810 T cells expressing low-avidity T cell receptors respond poorly to IL-15/IL-15Ralpha complex, which correlates with a poor homeostatic proliferative response to lymphopenia. PMID: 21041729 LFA-1 signal defect-induced CD8(+) T cell apoptosis is associated with reduced CD27 costimulation and IL-15R survival signal, elucidating the molecular mechanism associated with LFA-1 signaling in effector and memory CD8(+) T cell survival PMID: 20569988 Identified four novel IL15Ralpha splice variants in mouse cerebral microvessels composing the BBB, and showed their differential distribution and functions in endothelial signaling in response to IL15. PMID: 20374432 Data suggest that activation of hypothalamic neurons by IL-15 in mice contributes to thermoregulation and modifies the metabolic phenotype. PMID: 20012227 IL-15Ralpha(-/-) renal cells exhibited a higher rate of cisplatin-induced apoptosis PMID: 19958157 IL15R signaling is essential to maintain hippocampal GABA concentrations, at least partially involving reduced GABA turnover, and results in facilitation of memory consolidation. PMID: 20357123 Expression of soluble IL-15Ralpha (sIL-15Ralpha) mRNA declined 5-fold with age PMID: 19854259 Neuronal development in olfactory epithelium (OE) is inhibited by interleukin (IL)-15Ralpha deficiency because of decreased proliferative activity but not promoted apoptosis of OE cells PMID: 20021484 Data show that the short lifespan of T(H)17 cells was associated with small amounts of the antiapoptotic protein Bcl-2, the IL-15 receptor and the receptor CD27. PMID: 19935657 IL-15R alpha deficiency results in specific decreases in both the number and Bcl-2 content of CD8+ T cells. PMID: 11777964 Treatment with soluble interleukin-15Ralpha exacerbates intracellular parasitic infection by blocking the development of memory CD8+ T cell response. (IL-15R alpha) PMID: 12045244 Expression of the high-affinity receptor, IL-15R alpha, on T cells is dispensable for the generation or maintenance of memory CD8(+) T cells. By contrast, IL-15R alpha expression on cells other than T cells is absolutely critical for this function. PMID: 12671073 These findings demonstrate that natural killer (NK) cell-independent interleukin-15 receptor alpha (IL-15Ralpha) expression is critical for maintaining peripheral NK cells, while IL-15Ralpha expression on NK cells is not required for this function. PMID: 12695489 SOCS1 functions as an indispensable attenuator of IL-15 receptor signaling in developing CD8+ thymocytes PMID: 12907450 IL-15 receptor alpha chain expression on developing natural killer (NK) cells is not critically important for the development of CD94/NKG2+ lytic NK cells, but is required for further acquisition of Ly-49 receptors by NK cells. PMID: 14607906 IL-15 receptor alpha expression by murine dendritic cells is critical for natural killer (NK) cell activation and presentation of IL-15 in trans to NK cells during NK cell priming. PMID: 15356102 IL-15Ralpha defines homeostatic niches for NK and memory CD8+ T cells by controlling both the production and the presentation of IL-15 in trans to NK and CD8+ memory T cells PMID: 15452177 IL-15Ralpha can act in cis in addition to acting in trans to present IL-15 to responding cells. PMID: 18796634 IL-15 expression alone in TC-1 tumor cells partially inhibits tumor growth whereas IL-15 and IL-15Ralpha expression together completely inhibits tumor growth in a natural killer 1.1-positive cell- and CD8-positive T cell-dependent manner. PMID: 19050240 The decidual leucocytes also up-regulated IL-15 and IL-15Ralpha in stromal fibroblasts which could produce a niche for uNK cells allowing proliferation within and recruitment into the uterus. PMID: 19088135 Dendritic cell derived-exosomes promoted an IL-15Ralpha- and NKG2D-dependent NK cell proliferation and activation respectively, resulting in anti-metastatic effects PMID: 19319200 Results indicate that potential nuclear function of cleaved interleukin-2 receptor beta-chain and IL-15 receptor alpha-chain subunits is not plausible. PMID: 19329337 E4BP4 acted in a cell-intrinsic manner 'downstream' of the interleukin 15 receptor (IL-15R) and through the transcription factor Id2 PMID: 19749763 IL-15R alpha expression on macrophages but not dendritic cells (DCs) supports the early transition of antigen specific effector CD8(+) T cells to memory cells PMID: 19913445 Show More Hide All
Subcellular Location	Membrane; Single-pass type I membrane protein. Nucleus membrane; Single-pass type I membrane protein. Cell surface.; [Soluble interleukin-15 receptor subunit alpha]: Secreted, extracellular space.
Tissue Specificity	Widely expressed.
Database Links	KEGG: mmu:16169 STRING: 10090.ENSMUSP00000077878 UniGene: Mm.200196

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-AP004801MO
Size	InquiryPurchase it in Cusabio online store (only available for customers from the US)
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Interleukin-15 receptor subunit alpha(Il15ra),partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage