Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP004801MO |
| Product Type | Interleukin |
| Size | US$65 |
| Uniprot No. | Q60819 |
| Lead Time | 5-10 business days |
| Storage Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Alias | Interleukin-15 receptor subunit alpha;Il15ra;sIL-15 receptor subunit alpha |
| Species | Mus musculus (Mouse) |
| Biological_Activity | The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL?2 mouse cytotoxic T cells is less than 10 ng/ml. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK |
| Research Area | Immunology |
| Source | Mammalian cell |
| Gene Names | Il15ra |
| Expression Region | 33-205aa |
| Tag Info | C-terminal FC-tagged |
| Mol. Weight | 45.5 kDa |
| Protein Description | Partial |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Signal transduction involves SYK (By similarity). |
| Subcellular Location | Membrane, Single-pass type I membrane protein, Nucleus membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Soluble interleukin-15 receptor subunit alpha: Secreted, extracellular space |
| Tissue Specificity | Widely expressed. |
| Database Links |
KEGG: mmu:16169 STRING: 10090.ENSMUSP00000077878 UniGene: Mm.200196 |
| Pathway | Jak-STAT signaling pathway |
Il15ra Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP726679MO CSB-EP726679MO CSB-BP726679MO CSB-MP726679MO |
Recombinant Mouse Interleukin-15 receptor subunit alpha(Il15ra),partial | Yeast E.coli Baculovirus Mammalian cell |
Il15ra ELISA Kit for Mus musculus (Mouse)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL011594MO | Mouse Interleukin-15 receptor subunit alpha(IL15RA) ELISA kit | Request Information |
Recombinant Peptidoglycan-associated lipoprotein(pal)
Express system: E.coli
Species: Legionella pneumophila
Recombinant rat Microtubule-associated protein tau
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain(CD8A),partial
Express system: Yeast
Species: Bos taurus (Bovine)
Recombinant Human Receptor-type tyrosine-protein phosphatase C(PTPRC),partial
Express system: Yeast
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.