Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP004801MO |
| Product Type | Interleukin |
| Size |
$65Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.) |
| Uniprot No. | Q60819 |
| Image |
|
| Storage Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Alias | Interleukin-15 receptor subunit alpha;Il15ra;sIL-15 receptor subunit alpha |
| Species | Mus musculus (Mouse) |
| Biological_Activity | The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL?2 mouse cytotoxic T cells is less than 10 ng/ml. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK |
| Research Area | Immunology |
| Source | Mammalian cell |
| Gene Names | Il15ra |
| Expression Region | 33-205aa |
| Tag Info | C-terminal FC-tagged |
| Mol. Weight | 45.5 kDa |
| Protein Description | Partial |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Signal transduction involves SYK (By similarity). |
| Subcellular Location | Membrane, Single-pass type I membrane protein, Nucleus membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Soluble interleukin-15 receptor subunit alpha: Secreted, extracellular space |
| Tissue Specificity | Widely expressed. |
| Database Links |
KEGG: mmu:16169 STRING: 10090.ENSMUSP00000077878 UniGene: Mm.200196 |
| Pathway | Jak-STAT signaling pathway |
Il15ra Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP726679MO CSB-EP726679MO CSB-BP726679MO CSB-MP726679MO |
Recombinant Mouse Interleukin-15 receptor subunit alpha(Il15ra),partial | Yeast E.coli Baculovirus Mammalian cell |
Il15ra ELISA Kit for Mus musculus (Mouse)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL011594MO | Mouse Interleukin-15 receptor subunit alpha(IL15RA) ELISA kit | Request Information |
Recombinant Human papillomavirus type 16 Protein E7(E7)
Express system: E.coli
Species: Human papillomavirus type 16
Recombinant Human Androgen receptor(AR) ,partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human X-ray repair cross-complementing protein 5(XRCC5),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mpuse T-cell surface glycoprotein CD3 epsilon chain(Cd3e),partial
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Hydroxymethylglutaryl-CoA lyase, mitochondrial(HMGCL)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Cysteine-rich protein 1(CRIP1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Keratin, type II cytoskeletal 7(KRT7)
Express system: E.coli
Species: Homo sapiens (Human)
