Recombinant Mouse Interleukin-15 receptor subunit alpha(Il15ra),partial

In Stock
Code CSB-AP004801MO
Product Type Interleukin
Size US$65
Uniprot No. Q60819
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Interleukin-15 receptor subunit alpha;Il15ra;sIL-15 receptor subunit alpha
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL?2 mouse cytotoxic T cells is less than 10 ng/ml.
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK
Research Area Immunology
Source Mammalian cell
Gene Names Il15ra
Expression Region 33-205aa
Tag Info C-terminal FC-tagged
Mol. Weight 45.5 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Signal transduction involves SYK (By similarity).
Subcellular Location Membrane, Single-pass type I membrane protein, Nucleus membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Soluble interleukin-15 receptor subunit alpha: Secreted, extracellular space
Tissue Specificity Widely expressed.
Database Links

KEGG: mmu:16169

STRING: 10090.ENSMUSP00000077878

UniGene: Mm.200196

Pathway Jak-STAT signaling pathway

Related Products

Il15ra Proteins

Il15ra Proteins for Mus musculus (Mouse)

Il15ra ELISA Kit

Il15ra ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.