Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD74 at 2 μg/mL can bind Anti-CD74 recombinant antibody (CSB-RA004956A1HU), the EC50 is 1.317-1.646 ng/mL.
Alternative Names
(HLA-DR antigens-associated invariant chain)(Ia antigen-associated invariant chain)(Ii)(CD antigen CD74)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
73-232aa
Target Protein Sequence
QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM
Protein Length
Partial of Isoform 2
Tag Info
N-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant CD74 protein gene sequence Gln73-Met232 fused with an N-terminal 10xHis-tag was inserted into the prokaryotic expression vector to obtain the recombinant plasmid, which was transferred into mammalian cells for further expression. The final product is the recombinant human CD74 protein. Its purity reaches up to 95%. Its endotoxin and activity have been measured.
CD74 is the receptor for the cytokine MIF. CD74-MIF interaction activates CD74/CD44 complex further inducing the activation of ERK, PI3K-Akt, NF-κB, and AMPK pathways involved in cell proliferation and survival. Additionally, CD74-MIF signaling plays a vital role in protecting against injury and promoting healing in different body parts. CD74 also participates in the modulation of T cell and B cell development, dendritic cell (DC) motility, macrophage inflammation, and thymic selection. Many studies have shown that CD74 is complicated in the pathogenesis of many inflammatory diseases, such as Alzheimer's disease, systemic lupus erythematosus, and type I diabetes. CD74 expression has been proposed as a prognostic factor in numerous malignancies, with higher relative expression acting as a sign of tumor progression.