Code | CSB-MP004956HU1(F2) |
Size | $428 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
The recombinant CD74 protein gene sequence Gln73-Met232 fused with an N-terminal 10xHis-tag was inserted into the prokaryotic expression vector to obtain the recombinant plasmid, which was transferred into mammalian cells for further expression. The final product is the recombinant human CD74 protein. Its purity reaches up to 95%. Its endotoxin and activity have been measured. CD74 is the receptor for the cytokine MIF. CD74-MIF interaction activates CD74/CD44 complex further inducing the activation of ERK, PI3K-Akt, NF-κB, and AMPK pathways involved in cell proliferation and survival. Additionally, CD74-MIF signaling plays a vital role in protecting against injury and promoting healing in different body parts. CD74 also participates in the modulation of T cell and B cell development, dendritic cell (DC) motility, macrophage inflammation, and thymic selection. Many studies have shown that CD74 is complicated in the pathogenesis of many inflammatory diseases, such as Alzheimer's disease, systemic lupus erythematosus, and type I diabetes. CD74 expression has been proposed as a prognostic factor in numerous malignancies, with higher relative expression acting as a sign of tumor progression. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized Human CD74 at 2 μg/mL can bind Anti-CD74 recombinant antibody (CSB-RA004956A1HU), the EC50 is 1.317-1.646 ng/mL. |
Target Names | CD74 |
Uniprot No. | P04233 |
Alternative Names | (HLA-DR antigens-associated invariant chain)(Ia antigen-associated invariant chain)(Ii)(CD antigen CD74) |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 73-232aa |
Target Protein Sequence | QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM |
Mol. Weight | 21.0 kDa |
Protein Length | Partial of Isoform 2 |
Tag Info |
N-terminal 10xHis-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF.; Binds to the peptide-binding site of MHC class II alpha/beta heterodimers forming an alpha-beta-CLIP complex, thereby preventing the loading of antigenic peptides to the MHC class II complex until its release by HLA-DM in the endosome.; Stabilizes the conformation of mature CTSL by binding to its active site and serving as a chaperone to help maintain a pool of mature enzyme in endocytic compartments and extracellular space of antigen-presenting cells (APCs). Has antiviral activity by stymieing the endosomal entry of Ebola virus and coronaviruses, including SARS-CoV-2. Disrupts cathepsin-mediated Ebola virus glycoprotein processing, which prevents viral fusion and entry. This antiviral activity is specific to p41 isoform.
|
Gene References into Functions |
|
Involvement in disease | A chromosomal aberration involving CD74 is found in a non-small cell lung tumor. Results in the formation of a CD74-ROS1 chimeric protein. |
Subcellular Location | Cell membrane; Single-pass type II membrane protein. Endoplasmic reticulum membrane. Golgi apparatus, trans-Golgi network. Endosome. Lysosome. Note=Transits through a number of intracellular compartments in the endocytic pathway. It can either undergo proteolysis or reach the cell membrane.; [Isoform p41]: Late endosome. Lysosome. |
Tissue Specificity | [Isoform p41]: In B cells, represents 10% of total CD74 expression.; [Isoform p33]: In B cells, represents 70% of total CD74 expression. |
Database Links |
HGNC: 1697 OMIM: 142790 KEGG: hsa:972 STRING: 9606.ENSP00000009530 UniGene: Hs.436568 |