Recombinant Mouse Prolactin receptor (Prlr), partial (Active)

In Stock
Code CSB-MP018727MO
Size $268
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Mouse Prlr at 5 μg/ml can bind Anti-PRLR recombinant antibody (CSB-RA018727A0HU), the EC50 is 4.021-8.706 ng/mL.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Prlr at 5 μg/mL can bind Anti-PRLR recombinant antibody (CSB-RA018727A0HU), the EC50 is 4.021-8.706 ng/mL.
Target Names
Prlr
Uniprot No.
Alternative Names
(PRL-R)
Molecular Characterization
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
20-229aa
Target Protein Sequence
QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKD
Mol. Weight
27.3 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Mouse Prlr recombinant protein was produced in mammalian cell, where the gene sequence encoding Mouse Prlr (20-229aa) was expressed with the C-terminal 10xHis tag. The purity of this Prlr protein was greater than 95% by SDS-PAGE. The activity was measured in a functional ELISA.

Prolactin is a single-chain polypeptide hormone secreted by glandular eosinophils in the anterior pituitary of vertebrates, and widely acts on the gonads and mammary glands of animals. To perform its function, prolactin must bind to the prolactin receptor (PRLR), and act on the target cell through the receptor to cause various physiological and biochemical reactions of the target cell. Studies have shown that mutations in the prolactin gene and the prolactin receptor gene can cause reproductive dysfunction in animals. PRLR is involved in a variety of biological functions, including cell growth, differentiation, development, lactation and reproduction. Abnormal prolactin receptors are closely related to the incidence and prognosis of certain tumors, especially breast cancer.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a receptor for the anterior pituitary hormone prolactin.
Gene References into Functions
  1. Study shows prolactin receptors in Rip-cre cells, but not in AgRP neurones, are involved in energy homeostasis. Results indicate that Rip-Cre neurones in the arcuate nucleus are responsive to prolactin and may play a role in the orexigenic effects of prolactin, whereas prolactin does not directly affect Agrp neurones. PMID: 28378505
  2. The estrogen-responsive pituitary hormone prolactin (PRL), through specific PRL receptor (PRLR), down-regulates hepatic triglyceride (TG) accumulation. PMID: 29524401
  3. Truncating mutations of Prlr promote tumor growth in a model of human ERalpha+ breast cancer. PMID: 27681435
  4. This study demonstrated that there are at least two functional subpopulations of dopamine neurons in the arcuate nucleus, with approximately 50% of these neurons expressing GABA. PMID: 27581458
  5. Of the four placenta-specific, Prl-related hormones that have been shown to interact with the Prlr, their gene expression localizes to different endocrine cell types PMID: 26269505
  6. Prolactin receptor was upregulated in proximal kidney tubule cells of mice with cardiac disease. PMID: 23712540
  7. This study showed in knockout mice showed no effect of PRL and PRL-R gene ablation on heat and cold hyperalgesia in male mice, while heat hyperlgesia were reduced 3-72 h post-surgery in female PRL and PRL-R knockout mice PMID: 23994182
  8. The in utero environment of the Prlr(+/-) mother confers long-term changes in the pancreatic islets of her offspring such that when the offspring themselves became pregnant, they cannot adapt to the increased insulin demands of their own pregnancy. PMID: 23247113
  9. results provide direct genetic evidence that PRLR affects energy balance and metabolic adaptation in rodents via effects on brown adipose tissue differentiation and function PMID: 22637534
  10. Germline knockout of prolactin or its receptor has failed to reveal a key role for prolactin signaling in mouse prostate physiology. PMID: 21971318
  11. Data suggest that PRL stimulates the Prlr gene expression through the transcriptional activation of mE1(4) first exon, leading to increases in the long- and short-form variants of Prlr mRNA in the murine choroid plexus. PMID: 22294444
  12. deactivation of MAPK by PRL/PRL-RS contributes to the severe ovarian defect in PRLR(-/-)RS mice and demonstrate the novel association of PRL-RS with DUPD1 and a role for this phosphatase in MAPK deactivation PMID: 21199871
  13. Suggest that replacement of estrogen and progestin may not increase the mRNA of endometrial PRL receptor in metoclopromide-induced hyperprolactinemia in rats after castration. PMID: 19304288
  14. Results provide a detailed mapping of the prolactin-responsive neurons in the female mouse forebrain by describing the distribution of prolactin receptor mRNA. PMID: 19882722
  15. Pancreatic islets of PRLR-deficient mice were smaller, insulin mRNA levels were lower, glucose levels after an ip glucose load were higher PMID: 11897695
  16. developmental defect of PrlR(-/-) mammary epithelium is rescued by an exogenously expressed chimeric receptor (prl-EpoR) containing the PrlR extracellular domain joined to the EpoR transmembrane and intracellular domains PMID: 12381781
  17. results suggest that growth hormone can improve mammary development in prolactin receptor(+/-) mice, but that it fails to enhance metabolic activity PMID: 12399427
  18. data suggest that CCAAT enhancer binding protein-beta is a master regulator of mammary epithelial cell fate and correct spatial pattern of progesterone receptor and prolactin receptor expression is critical for hormone-regulated cell proliferati PMID: 12456789
  19. PR-1, the short form of the PRLR, can improve mammary development in PRLR+/- mice. This effect is probably caused by accelerated proliferation and an activation of the PRLR signaling cascade. PMID: 12624115
  20. This protein and its substrates, expressed in murine hair follicle epithelium, show hair cycle-dependent expression, and induce catagen. PMID: 12707045
  21. function of the SPRLR and a local and targeted effect of PRL on the mammary gland that are essential for its function, but not for its development. PMID: 12746331
  22. results demonstrate that prostaglandin F2alpha inhibits the expression of the prolactin receptor PMID: 12865306
  23. the absence of prolactin receptor signaling is not detrimental to male testicular function and to fertility in the mouse. PMID: 12933648
  24. the expression of a constitutively active PRL-R by transgenesis induces a premature and abnormal mammary development and impairs terminal differentiation and milk production at the end of pregnancy. PMID: 14613905
  25. These findings suggest a complex tissue-specific regulation of prolactin receptor expression in the context of the acute-phase response PMID: 15186999
  26. different isoforms of prolactin receptors may be present in the various stages of mouse preimplantation embryo and may play an important role in the control of its growth and development PMID: 15820039
  27. Cathepsin D secreted from various tissues is able to process PRL into 16K PRL outside the cell. PMID: 16959874
  28. Report is the first in vivo demonstration that the action of pregnancy hormones, acting through Prlr, is required for normal maternal glucose tolerance during pregnancy by increasing beta-cell mass. PMID: 19036882
  29. Prolactin independent rescue of mouse corpus luteum life span. PMID: 19531635

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Type I cytokine receptor family, Type 1 subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 322 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join Us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*