Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Prlr at 5 μg/mL can bind Anti-PRLR recombinant antibody (CSB-RA018727A0HU), the EC₅₀ is 4.021-8.706 ng/mL.

Target Names

Prlr

Uniprot No.

Q08501

Alternative Names

(PRL-R)

Molecular Characterization

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

20-229aa

Target Protein Sequence

QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKD

Mol. Weight

27.3 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The extracellular ligand-binding domain of mouse prolactin receptor (aa 20–229) provides the critical region for prolactin engagement, making this construct particularly suited for ligand-binding interaction assays, competitive inhibition studies, and blocking antibody screening. Functional ELISA validation confirms robust binding activity, with immobilized Prlr at 5 μg/mL engaging an anti-PRLR recombinant antibody at an EC50 of 4.021–8.706 ng/mL, supporting its use as a reliable positive control in binding assays or as a target for therapeutic antibody epitope mapping. Mammalian cell expression preserves native glycosylation and conformational integrity of the extracellular domain, which aligns with standards expected in SPR- and BLI-based affinity characterization where proper folding directly impacts kinetic measurements. This C-terminal 10×His-tagged protein meets the quality thresholds commonly required for drug discovery screening workflows, with purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg by LAL.

Target Background

Function

This is a receptor for the anterior pituitary hormone prolactin.

Gene References into Functions

Study shows prolactin receptors in Rip-cre cells, but not in AgRP neurones, are involved in energy homeostasis. Results indicate that Rip-Cre neurones in the arcuate nucleus are responsive to prolactin and may play a role in the orexigenic effects of prolactin, whereas prolactin does not directly affect Agrp neurones. PMID: 28378505
The estrogen-responsive pituitary hormone prolactin (PRL), through specific PRL receptor (PRLR), down-regulates hepatic triglyceride (TG) accumulation. PMID: 29524401
Truncating mutations of Prlr promote tumor growth in a model of human ERalpha+ breast cancer. PMID: 27681435
This study demonstrated that there are at least two functional subpopulations of dopamine neurons in the arcuate nucleus, with approximately 50% of these neurons expressing GABA. PMID: 27581458
Of the four placenta-specific, Prl-related hormones that have been shown to interact with the Prlr, their gene expression localizes to different endocrine cell types PMID: 26269505
Prolactin receptor was upregulated in proximal kidney tubule cells of mice with cardiac disease. PMID: 23712540
This study showed in knockout mice showed no effect of PRL and PRL-R gene ablation on heat and cold hyperalgesia in male mice, while heat hyperlgesia were reduced 3-72 h post-surgery in female PRL and PRL-R knockout mice PMID: 23994182
The in utero environment of the Prlr(+/-) mother confers long-term changes in the pancreatic islets of her offspring such that when the offspring themselves became pregnant, they cannot adapt to the increased insulin demands of their own pregnancy. PMID: 23247113
results provide direct genetic evidence that PRLR affects energy balance and metabolic adaptation in rodents via effects on brown adipose tissue differentiation and function PMID: 22637534
Germline knockout of prolactin or its receptor has failed to reveal a key role for prolactin signaling in mouse prostate physiology. PMID: 21971318
Data suggest that PRL stimulates the Prlr gene expression through the transcriptional activation of mE1(4) first exon, leading to increases in the long- and short-form variants of Prlr mRNA in the murine choroid plexus. PMID: 22294444
deactivation of MAPK by PRL/PRL-RS contributes to the severe ovarian defect in PRLR(-/-)RS mice and demonstrate the novel association of PRL-RS with DUPD1 and a role for this phosphatase in MAPK deactivation PMID: 21199871
Suggest that replacement of estrogen and progestin may not increase the mRNA of endometrial PRL receptor in metoclopromide-induced hyperprolactinemia in rats after castration. PMID: 19304288
Results provide a detailed mapping of the prolactin-responsive neurons in the female mouse forebrain by describing the distribution of prolactin receptor mRNA. PMID: 19882722
Pancreatic islets of PRLR-deficient mice were smaller, insulin mRNA levels were lower, glucose levels after an ip glucose load were higher PMID: 11897695
developmental defect of PrlR(-/-) mammary epithelium is rescued by an exogenously expressed chimeric receptor (prl-EpoR) containing the PrlR extracellular domain joined to the EpoR transmembrane and intracellular domains PMID: 12381781
results suggest that growth hormone can improve mammary development in prolactin receptor(+/-) mice, but that it fails to enhance metabolic activity PMID: 12399427
data suggest that CCAAT enhancer binding protein-beta is a master regulator of mammary epithelial cell fate and correct spatial pattern of progesterone receptor and prolactin receptor expression is critical for hormone-regulated cell proliferati PMID: 12456789
PR-1, the short form of the PRLR, can improve mammary development in PRLR+/- mice. This effect is probably caused by accelerated proliferation and an activation of the PRLR signaling cascade. PMID: 12624115
This protein and its substrates, expressed in murine hair follicle epithelium, show hair cycle-dependent expression, and induce catagen. PMID: 12707045
function of the SPRLR and a local and targeted effect of PRL on the mammary gland that are essential for its function, but not for its development. PMID: 12746331
results demonstrate that prostaglandin F2alpha inhibits the expression of the prolactin receptor PMID: 12865306
the absence of prolactin receptor signaling is not detrimental to male testicular function and to fertility in the mouse. PMID: 12933648
the expression of a constitutively active PRL-R by transgenesis induces a premature and abnormal mammary development and impairs terminal differentiation and milk production at the end of pregnancy. PMID: 14613905
These findings suggest a complex tissue-specific regulation of prolactin receptor expression in the context of the acute-phase response PMID: 15186999
different isoforms of prolactin receptors may be present in the various stages of mouse preimplantation embryo and may play an important role in the control of its growth and development PMID: 15820039
Cathepsin D secreted from various tissues is able to process PRL into 16K PRL outside the cell. PMID: 16959874
Report is the first in vivo demonstration that the action of pregnancy hormones, acting through Prlr, is required for normal maternal glucose tolerance during pregnancy by increasing beta-cell mass. PMID: 19036882
Prolactin independent rescue of mouse corpus luteum life span. PMID: 19531635

Hide All

Subcellular Location

Membrane; Single-pass type I membrane protein.

Protein Families

Type I cytokine receptor family, Type 1 subfamily

Database Links

KEGG: mmu:19116

STRING: 10090.ENSMUSP00000122219

UniGene: Mm.10516

Code	CSB-MP018727MO
Abbreviation	Recombinant Mouse Prlr protein, partial (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Mouse Prlr at 5 μg/ml can bind Anti-PRLR recombinant antibody (CSB-RA018727A0HU), the EC₅₀ is 4.021-8.706 ng/mL.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Prolactin receptor (Prlr), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage