Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Prlr at 5 μg/mL can bind Anti-PRLR recombinant antibody (CSB-RA018727A0HU), the EC50 is 4.021-8.706 ng/mL.
Molecular Characterization
Species
Mus musculus (Mouse)
Expression Region
20-229aa
Target Protein Sequence
QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKD
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Mouse Prlr recombinant protein was produced in mammalian cell, where the gene sequence encoding Mouse Prlr (20-229aa) was expressed with the C-terminal 10xHis tag. The purity of this Prlr protein was greater than 95% by SDS-PAGE. The activity was measured in a functional ELISA.
Prolactin is a single-chain polypeptide hormone secreted by glandular eosinophils in the anterior pituitary of vertebrates, and widely acts on the gonads and mammary glands of animals. To perform its function, prolactin must bind to the prolactin receptor (PRLR), and act on the target cell through the receptor to cause various physiological and biochemical reactions of the target cell. Studies have shown that mutations in the prolactin gene and the prolactin receptor gene can cause reproductive dysfunction in animals. PRLR is involved in a variety of biological functions, including cell growth, differentiation, development, lactation and reproduction. Abnormal prolactin receptors are closely related to the incidence and prognosis of certain tumors, especially breast cancer.