Thanks for your inquiry.
Recombinant Human Apolipoprotein L1(APOL1)
CSB-YP001940HU >> Yeast
CSB-EP001940HU >> E.coli
CSB-BP001940HU >> Baculovirus
CSB-MP001940HU >> Mammalian cell
Expression Region: 28-398aa; Full length of the mature protein.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Target Protein Sequence:
EEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTMDPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWFLKEFPRLKSELEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFTEGGSLVLLEPGMELGITAALTGITSSTMDYGKKWWTQAQAHDLVIKSLDKLKEVREFLGENISNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNNNYKILQADQEL
Please remark your requirement for tag removal if you need the untagged protein or tag removal when placing the order.
We can try enzyme digestion, we are sure the C-terminal tag can be removed, but we can't 100% guarantee N-terminal tag can be removed successfully.
The overall success rate of enzyme digestion data analysis is 75%-86%.
a. Not all protein tags can be removed as some proteins will be very unstable after tag removal.
b. If we succeed in removing the tag, we will charge for extra cost accordingly.
c. If we fail in removing the tag, we won’t charge for any extra cost and provide the fusion protein, and remark this information in datasheet as follows
“Note: The laboratory determined that the Tag on your protein could not be removed with standard laboratory procedures. Your protein is being supplied with the Tag intact.”
Generally, the delivery time will be extended for 3 working days.