Recombinant Human Carbamoyl-phosphate synthase [ammonia], mitochondrial (CPS1), partial

In Stock
Code CSB-EP005913HU
Abbreviation Recombinant Human CPS1 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CPS1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Carbamoyl phosphate synthase [ammonia]; Carbamoyl phosphate synthase [ammonia] mitochondrial; Carbamoyl phosphate synthase; Carbamoyl phosphate synthetase 1; Carbamoyl phosphate synthetase 1 mitochondrial; Carbamoyl phosphate synthetase I; Carbamoyl-phosphate synthase [ammonia]; Carbamoyl-phosphate synthetase I; Carbamoylphosphate synthase; Carbamoylphosphate synthetase 1; Carbamoylphosphate synthetase I; CPS 1; Cps1; CPSase 1; CPSase I; CPSASE1; CPSM_HUMAN; mitochondrial; MS738
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1354-1500aa
Target Protein Sequence
GFKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.5 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the urea cycle of ureotelic animals where the enzyme plays an important role in removing excess ammonia from the cell.
Gene References into Functions
  1. In silico analysis potentially links CPS1 SNPs with major depression disorder. PMID: 29441491
  2. Allele and genotype frequencies of the p.Thr1406Asn polymorphism did not differ between the infants with and without NEC, but the minor A-allele was less frequent in the group of 64 infants with the combined outcome NEC or death before 34 weeks of corrected gestational age than in the infants without this outcome. A significant negative association of the A-allele with the combined outcome NEC or death was found. PMID: 27833157
  3. HNF3beta plays a vital role in regulation of CPS1 gene and could promote the metabolism of ammonia by regulating CPS1 expression. PMID: 28272778
  4. CPS1 maintains pyrimidine pools and DNA synthesis in KRAS/LKB1-mutant lung cancer cells PMID: 28538732
  5. CPS1 knockdown reduced cell growth, decreased levels of metabolites associated with nucleic acid biosynthesis. PMID: 28376202
  6. These results may offer an increasing understand that CPS1 might have a function in differentiation. PMID: 27425868
  7. Molecular structure of CPS1 has been deciphered. PMID: 26592762
  8. CPS1 and CPS1IT1 may be potential prognostic indicators for patients with intrahepatic cholangiocarcinoma. PMID: 26499888
  9. CPS1 is involved in the urea cycle in weight maintenance. PMID: 26938218
  10. These results suggest that glycine metabolism and/or the urea cycle represent potentially novel sex-specific mechanisms for the development of atherosclerosis. PMID: 26822151
  11. Mechanism for Switching On/Off the Urea Cycle PMID: 26059772
  12. More HCC cells could be identified by the antibody cocktail for CPS1 and P-CK compared with a single antibody. PMID: 24763545
  13. characterized the only currently known recurrent CPS1 mutation, p.Val1013del found in eleven unrelated patients of Turkish descent; mutation p.V1013del inactivates CPS1 but does not render the enzyme grossly unstable or insoluble PMID: 25410056
  14. Overexpression of CPS1 is associated with rectal cancers. PMID: 25099619
  15. study examined patient characteristics, including genetic polymorphism, to identify risk factors associated with development of hyperammonemia during valproic acid-based therapy; found CPS1 4217C>A polymorphism may not be associated with development of hyperammonemia in Japanese population PMID: 24888247
  16. Findings support the disease-causing role of the mutations reported to affect the CPS1 deficiency, revealing a key role of the small CPS1 domain of unknown function (UFSD) for proper enzyme folding. PMID: 24813853
  17. CPS1 becomes readily detectable upon hepatocyte apoptotic and necrotic death. Its abundance and short serum half-life suggest that it may be a useful prognostic biomarker in acute liver injury. PMID: 24924744
  18. Data show that carbamoyl phosphate synthetase 1, an enzyme involved in the urea cycle, 8-oxoguanine DNA glycosylase 1 and DNA polymerase beta, enzymes involved in DNA repair, were expressed at higher levels in Batten disease cells than in normal cells. PMID: 22692827
  19. the human CPS unknown function domains are spatially located in a region that corresponds to the a/b subunits interface in Escherichia coli CPS. [Review] PMID: 22521883
  20. Mutation analysis in these patients identified 17 genetic lesions, 9 of which were new confirming their "private" nature. PMID: 22173106
  21. Case Report: Late-onset carbamoyl phosphate synthetase 1 deficiency in an adult cured by liver transplantation. PMID: 21837743
  22. This is the first large-scale report of CPS1 mutations spanning a wide variety of molecular defects highlighting important regions in this protein. PMID: 21120950
  23. DNA methylation is a key mechanism of silencing CPS1 expression in human hepatocellular carcinoma cells. PMID: 21281797
  24. structure-function analysis and pathogenicity-testing of mutations in CPS1 PMID: 20800523
  25. Data reported five of the CPS1 mutations (p.T471N, p.Q678P, p.P774L, p.R1453Q, and p.R1453W) in severe CPS1D patients. PMID: 20578160
  26. The present study in preterm infants did not confirm the earlier reported association between CPS1 genotype and L-arginine levels in term infants. PMID: 20520828
  27. These data confirm a recent finding that CPS1 is a locus influencing homocysteine levels in women and suggest that genetic effects on Hcy may differ across developmental stages. PMID: 20154341
  28. Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 20383146
  29. Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 20154341
  30. CPS1, MUT, NOX4, and DPEP1 is associated with plasma homocysteine in healthy Women. PMID: 20031578
  31. Allelic imbalance may explain clinical variability in CPS1 deficiency in some families. PMID: 19793055
  32. The entire DNA sequence of the human CPS1 gene is presented, including all exon-intron boundaries. PMID: 12655559
  33. CPSI T1405N genotype appears to be an important new factor in predicting susceptibility to pulmonry hypertension following surgical repair of congenital cardiac defects in children. PMID: 17188582
  34. CPPS1 T1404N polymorphism may be associated with the risk of necrotizing enterocolitis in preterm infants. PMID: 17597649
  35. Tight hydrogen binding mode is supported by the observation of reduced NAG affinity upon mutation of N-acetyl-L-glutamate-interacting residues of CPSI PMID: 19754428
  36. The differential expression of Hep Par 1(carbamoyl phosphate synthetase I) in dysplastic vs malignant tumors of the small intestine may be diagnostically useful in difficult cases. PMID: 19926579

Show More

Hide All

Involvement in disease
Carbamoyl phosphate synthetase 1 deficiency (CPS1D); Pulmonary hypertension, neonatal (PHN)
Subcellular Location
Mitochondrion. Nucleus, nucleolus.
Tissue Specificity
Primarily in the liver and small intestine.
Database Links

HGNC: 2323

OMIM: 237300

KEGG: hsa:1373

STRING: 9606.ENSP00000402608

UniGene: Hs.149252

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*