Recombinant Human Cardiac phospholamban (PLN)

In Stock
Code CSB-YP018198HU
Abbreviation Recombinant Human PLN protein
MSDS
Size $250
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Cardiac phospholamban; CMD1P; CMH18; PLB; Pln; PPLA_HUMAN
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-52aa
Target Protein Sequence
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.1kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The pipeline for the recombinant human Cardiac phospholamban (PLN) production in yeast cells consists of the following consecutive steps: construction of the expression vector encoding the human PLN protein (1-52aa) fused with the N-terminal GST-tag, its transformation into yeast cells, high-density cultivation and induction of the positive cells, cell lysis, and expression analysis. The resulting recombinant human PLN protein is purified from the cell lysate through affinity purification, and its purity is greater than 90% as determined by the SDS-PAGE.

PLN is a crucial protein regulating calcium homeostasis in cardiac muscle cells. It acts as the principal regulator of the Ca2+-ATPase of the cardiac sarcoplasmic reticulum [1]. PLN is an integral membrane protein that modulates cardiac muscle contractility by maintaining calcium balance within cardiomyocytes [2]. It is known to control the activity of the sarcoplasmic reticulum Ca2+ pump, which is essential for calcium-mediated muscle relaxation [3].

Structurally, phospholamban is a 52-amino acid membrane protein that can assemble into a pentamer within the sarcoplasmic reticulum membranes [4]. It contains an α-helical transmembrane segment and a cytoplasmic domain that exhibits structural disorder [5]. Phospholamban is phosphorylated in response to β-adrenergic stimulation, which affects its inhibitory effect on the Ca2+ ATPase [6]. The phosphorylation of phospholamban is important in regulating cardiac contraction and relaxation [7].

Phospholamban also modulates cardiac function. Studies have shown that phospholamban knockout mice exhibit altered intracellular calcium transients and myocardial contractility [8]. Furthermore, phospholamban regulates the cardiac Ca-ATPase (SERCA2) as an inhibitory cofactor [9].

References:
[1] H. Simmerman and L. Jones, Phospholamban: protein structure, mechanism of action, and role in cardiac function, Physiological Reviews, vol. 78, no. 4, p. 921-947, 1998. https://doi.org/10.1152/physrev.1998.78.4.921
[2] J. Zamoon, A. Mascioni, D. Thomas, & G. Veglia, Nmr solution structure and topological orientation of monomeric phospholamban in dodecylphosphocholine micelles, Biophysical Journal, vol. 85, no. 4, p. 2589-2598, 2003. https://doi.org/10.1016/s0006-3495(03)74681-5
[3] R. Brusa, F. Magri, N. Bresolin, G. Comi, & S. Corti, Noncoding rnas in duchenne and becker muscular dystrophies: role in pathogenesis and future prognostic and therapeutic perspectives, Cellular and Molecular Life Sciences, vol. 77, no. 21, p. 4299-4313, 2020. https://doi.org/10.1007/s00018-020-03537-4
[4] I. Arkin, P. Adams, A. Brunger, S. Smith, & D. Engelman, Structural perspectives of phospholamban, a helical transmembrane pentamer, Annual Review of Biophysics and Biomolecular Structure, vol. 26, no. 1, p. 157-179, 1997. https://doi.org/10.1146/annurev.biophys.26.1.157
[5] O. Andronesi, S. Becker, K. Seidel, H. Heise, H. Young, & M. Baldus, Determination of membrane protein structure and dynamics by magic-angle-spinning solid-state nmr spectroscopy, Journal of the American Chemical Society, vol. 127, no. 37, p. 12965-12974, 2005. https://doi.org/10.1021/ja0530164
[6] I. Arkin, M. Rothman, C. Ludlam, S. Aimoto, D. Engelman, K. Rothschildet al., Structural model of the phospholamban ion channel complex in phospholipid membranes, Journal of Molecular Biology, vol. 248, no. 4, p. 824-834, 1995. https://doi.org/10.1006/jmbi.1995.0263
[7] C. Mundiña-Weilenmann, L. Vittone, M. Ortale, G. Cingolani, & A. Mattiazzi, Immunodetection of phosphorylation sites gives new insights into the mechanisms underlying phospholamban phosphorylation in the intact heart, Journal of Biological Chemistry, vol. 271, no. 52, p. 33561-33567, 1996. https://doi.org/10.1074/jbc.271.52.33561
[8] J. Autry and L. Jones, Functional co-expression of the canine cardiac ca2+pump and phospholamban in spodoptera frugiperda (sf21) cells reveals new insights on atpase regulation, Journal of Biological Chemistry, vol. 272, no. 25, p. 15872-15880, 1997. https://doi.org/10.1074/jbc.272.25.15872
[9] M. Tada, M. Yabuki, & T. Toyofuku, Molecular regulation of phospholamban function and gene expressiona, Annals of the New York Academy of Sciences, vol. 853, no. 1, p. 116-129, 1998. https://doi.org/10.1111/j.1749-6632.1998.tb08261.x

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I ask if there is a cleavage site between the GST tag and the protein for item CSB-YP018198HU Recombinant Homo sapiens Cardiac phospholamban.

A:
Very nice to receive your inquiry. The product details are as below.
Code: CSB-YP018198HU
Name: Recombinant Human Cardiac phospholamban(P26678)
Lead Time for Regular Size: 22-32 working days.
Expression Region: 1-52aa, full length
Tag Info: N-terminal GST-tag
Target Protein Sequence:

MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL


The sequence of GST-tag is as below.

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFRT


The restriction site is LGSPEF. The enzyme is PSP (PreScission Protease).
Q:

I would like to know if the PLN is at the N-terminal of the GST or the GST is at the N terminal of the PLN?

A:

The GST tag is located at the N-terminus of PLN.

Target Background

Function
Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation.
Gene References into Functions
  1. 2 lethal PLN mutations, R9C and R25C, which lead to dilated cardiomyopathy, were studied by biomolecular NMR. R25C enhances phospholmaban dynamics and shifts the conformational equilibrium toward the R state. R9C drives the amphipathic cytoplasmic domain toward the membrane-associate state, enriching the T state. PMID: 29501609
  2. Structure-Function Relationship of the SERCA Pump and Its Regulation by Phospholamban and Sarcolipin. PMID: 29594859
  3. The co-transfection of VHL and PLN in HEK293 cells decreased PLN expression under oxidative stress, whereas knockdown of VHL increased PLN expression both under normal and oxidative stress conditions. PMID: 29068413
  4. Hearts from patients with a p. Arg14del PLN mutation have a pattern of Right Ventricle Fibrofatty Replacement and Left Ventricular Fibrosis with fatty changes mostly in the posterolateral wall, independently of clinical presentation. PMID: 28365402
  5. LMOD1, SYNPO2, PDLIM7, PLN, and SYNM down-regulation reflect the altered phenotype of smooth muscle cells in vascular disease and could be early sensitive markers of SMC dedifferentiation. PMID: 27470516
  6. microRNAs (miRNAs) 1 and 21 bind PLN strongly and relieve PLN inhibition of SERCA to a greater extent than a similar length random sequence RNA mixture. PMID: 27531746
  7. Data suggest phospholamban (PLN) gene is a rare cause of cardiomyopathy in African patients. PMID: 26917049
  8. Phospholamban and sarcolipin are membrane proteins that differentially regulate SERCA function. (Review) PMID: 26743715
  9. PLN may be a key molecular player in rigid substrate-induced cellular hypertrophy in eosinophilic esophagitis. PMID: 26542032
  10. These data suggest that PLN is, at least partially, oligo-ubiquitinated at Lys(3) and degraded through Ser(16)-phosphorylation-mediated poly-ubiquitination during heart failure. PMID: 26966065
  11. hereditary mutants of phospholamban are associated with heart failure [review] PMID: 25563649
  12. PLN pentamers reduce phosphorylation of monomers at baseline and delay monomer phosphorylation upon PKA stimulation leading to increased interaction of PLN monomers with SERCA2a. PMID: 25562800
  13. Phospholamban R14del mutation carriers are at high risk for malignant ventricular arrhythmias and end-stage heart failure, with left ventricular ejection fraction <45% and sustained or nonsustained ventricular tachycardia as independent risk factors. PMID: 24909667
  14. Although SLN and PLB binding to SERCA have different functional outcomes on the coupling efficiency of SERCA, both proteins decrease the apparent Ca(2+) affinity of the pump, suggesting that SLN and PLB inhibit SERCA by using a similar mechanism. PMID: 25983321
  15. Phospholamban, and its interacting partners, regulates excitation contraction coupling and myocardial contraction. [Review] PMID: 25451386
  16. PLN mutations rarely cause cardiomyopathy PMID: 25928149
  17. analysis of how the conformational dynamics of protein kinase A induced by a lethal mutant of phospholamban hinder phosphorylation PMID: 25775607
  18. Aim of the present study is to determine the exact pattern of fibrosis and fatty replacement in PLN p.Arg14del mutation positive patients. PMID: 24732829
  19. Engineered upregulation of PLB expression in hESC/iPSC-vCMs restores a positive inotropic response to beta-adrenergic stimulation. PMID: 25504561
  20. a previously unrecognized mechanism for ESM cell contraction that depends on TGF-beta1, its receptors, and PLN. PMID: 24835503
  21. We conclude that PLB C-terminal residues are critical for localization, oligomerization, and regulatory function. In particular, the PLB C terminus is an important determinant of the quaternary structure of the SERCA regulatory complex. PMID: 25074938
  22. SLN and PLN are co-expressed in most fibers, which suggests that super-inhibition of SERCAs may be physiologically important in the regulation of intracellular Ca2+ in human skeletal muscle. PMID: 24358354
  23. Report PLN mutations in dilated cardiomyopathy. PMID: 24037902
  24. A PLN founder mutation and LMNA mutations were most prevalent and often demonstrated a specific phenotype in dilated cardiomyopathy patients PMID: 23349452
  25. PLN mutation carriers have ARVD/C characteristics, including important right ventricular involvement, and additionally more often low-voltage electrocardiograms, inverted T waves in the left precordial leads, and left ventricular involvement. PMID: 23871674
  26. In the context of data on PLN/SERCA interaction and on Ca(2+) accumulation in the sarcoplasmic reticulum the present results are consistent with the view that PLN channel activity could participate in the balancing of charge during Ca(2+) uptake. PMID: 23308118
  27. The researchers found evidence of an association between the phospholamban R14del and the presence of dilated or arrhythmogenic cardiomyopathies in a group of patients. PMID: 22820313
  28. 1,014 patients with heart failure screened for mutations in PLN gene; identified 4 unrelated patients with PLN mutations, 3 in same amino acid residue (R9); conclude mutations in PLN gene are rare cause of heart failure, present almost exclusively in patients with dilated cardiomyopathy etiology; Arg9 and Leu39 residues are leading location of mutations described to date PMID: 22137083
  29. human PLN-R14Del is misrouted to the sarcolemma, in the absence of endogenous PLN, and alters NKA activity, leading to cardiac remodeling. PMID: 22155237
  30. Hydrophobic imbalance in the cytoplasmic domain of phospholamban is a determinant for lethal dilated cardiomyopathy. PMID: 22427649
  31. TOAC spin labels placed on the WT-PLB transmembrane domain showed highly restricted motion with more than 100ns rotational correlation time (tau(c)); whereas the loop, and the cytoplasmic regions each consists of two distinct motional dynamics PMID: 22172806
  32. Characterizing phospholamban to sarco(endo)plasmic reticulum Ca2+-ATPase 2a (SERCA2a) protein binding interactions in human cardiac sarcoplasmic reticulum vesicles using chemical cross-linking. PMID: 22247554
  33. PLN generates canonical ion channel fluctuations with two conductance levels and a moderate cation selectivity PMID: 21687864
  34. both topology and function of PLN are shaped by the interactions with lipids, which fine-tune the regulation of SERCA PMID: 21576492
  35. PLN gene mutations were not found to be associated with HCM in the study group. PMID: 21332051
  36. Lethal Arg9Cys phospholamban mutation hinders Ca2+-ATPase regulation and phosphorylation by protein kinase A. PMID: 21282613
  37. Mutations in PLN are rare in frequency, yet the small size of the genetic locus may make it amenable to inclusion on HCM gene test panels. PMID: 21167350
  38. In this study, they investigated the effects of PLB phosphorylation and mutation on the interaction between a PLB oligomer and SERCA in the context of 2D crystals. PMID: 21108950
  39. Study conclude that PLN is enriched in the ER due to COP I-mediated transport that is dependent on its intact di-arginine motif and that the N-terminal di-arginine motif may act as a general ER retrieval sequence. PMID: 20634894
  40. sarcolipin binds to phospholamban and inhibits polymerization PMID: 12032137
  41. phosphorylation of phospholamban does not affect its structure and gives it more loose helical packing than if not phosphorylated PMID: 12080135
  42. Modeling of the inhibitory interaction of phospholamban with the Ca2+ ATPase. PMID: 12525698
  43. report that an inherited human dilated cardiomyopathy with refractory congestive heart failure is caused by a dominant Arg --> Cys missense mutation at residue 9 (R9C) in phospholamban PMID: 12610310
  44. role in regulating sarco(endo)plasmic reticulum Ca2+-ATPase by binding to transmembrane helices in conjunction with sarcolipin PMID: 12692302
  45. Mutation of the phospholamban promoter associated with hypertrophic cardiomyopathy. PMID: 12705874
  46. SERCA2a and phospholamban bind to S100A1 in the human heart PMID: 12804600
  47. The frequency-dependent phosphorylation of Ser16-PLB may favor an increase in Ca2+ transient and force generation in humans. PMID: 14530977
  48. This study concludes that phospholamban (PLB) increases the maximal activity (Vmax) of calcium (Ca2+)-ATPase, and that the magnitude of this effect is sensitive to mutation. A region of mutant PLB responsible for this regulatory property is identified. PMID: 15736939
  49. The unusual bellflower-like assembly is held together by leucine/isoleucine zipper motifs along the membrane-spanning helices. PMID: 16043693
  50. the nonreversible superinhibitory function of mutant PLN-R14Del may lead to inherited dilated cardiomyopathy and premature death in both humans and mice PMID: 16432188

Show More

Hide All

Involvement in disease
Cardiomyopathy, dilated 1P (CMD1P); Cardiomyopathy, familial hypertrophic 18 (CMH18)
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Sarcoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein. Membrane; Single-pass membrane protein.
Protein Families
Phospholamban family
Tissue Specificity
Heart muscle (at protein level).
Database Links

HGNC: 9080

OMIM: 172405

KEGG: hsa:5350

STRING: 9606.ENSP00000350132

UniGene: Hs.170839

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*