Recombinant Human Cardiac phospholamban(P26678)

Code CSB-YP018198HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P26678
Relevance Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca2+. Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
Research Area Cardiovascular
Source Yeast
Gene Names PLN
Protein Names Recommended name: Cardiac phospholamban Short name= PLB
Expression Region 1-52aa
Tag Info N-terminal GST-tagged
Mol. Weight 33.1kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation.
Involvement in disease Cardiomyopathy, dilated 1P (CMD1P); Cardiomyopathy, familial hypertrophic 18 (CMH18)
Subcellular Location Endoplasmic reticulum membrane, Single-pass membrane protein, Sarcoplasmic reticulum membrane, Single-pass membrane protein, Mitochondrion membrane, Single-pass membrane protein, Membrane, Single-pass membrane protein
Protein Families Phospholamban family
Tissue Specificity Heart muscle (at protein level).
Database Links

HGNC: 9080

OMIM: 172405

KEGG: hsa:5350

STRING: 9606.ENSP00000350132

UniGene: Hs.170839

Pathway Calcium signaling pathway
cAMP signaling pathway
cGMP-PKG signaling pathway

Q&A and Customer Reviews

Q&A
Q:

I ask if there is a cleavage site between the GST tag and the protein for item CSB-YP018198HU Recombinant Homo sapiens Cardiac phospholamban.

A:
Very nice to receive your inquiry. The product details are as below.
Code: CSB-YP018198HU
Name: Recombinant Human Cardiac phospholamban(P26678)
Lead Time for Regular Size: 22-32 working days.
Expression Region: 1-52aa, full length
Tag Info: N-terminal GST-tag
Target Protein Sequence:

MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL


The sequence of GST-tag is as below.

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFRT


The restriction site is LGSPEF. The enzyme is PSP (PreScission Protease).
Customer Reviews

Related Products

PLN Antibodies

PLN Antibodies for Homo sapiens (Human)

PLN Proteins

PLN Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.