Code | CSB-YP018198HU |
MSDS | |
Size | $250 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
The DNA fragment encoding the 1-52aa of the human PLN protein was fused with N-terminal GST tag gene and then was inserted into the expression vector, which was subsequently transfected into the yeast cells for expression. The resulting product was further purified to obtain the recombinant human PLN protein. The purity of this recombinant PLN protein is greater than 90% assessed by Bandscan software analysis combined with SDS-PAGE. This recombinant PLN protein showed a band on the gel with a molecular weight of approximately 25-31 kDa.
Recent research has uncovered important roles of PLN in dilated cardiomyopathy (DCM) and heart failure (HF), but there is still limited knowledge of the specified mechanism of PLN in diseases. In addition, it has been confirmed that glomerulonephritis and amyloidosis is closely related to the abnormal expressed PLN. Many studies suggested that PLN is a promising therapeutic modality in heart failure. Targeting PLN could be alternative strategy for treatment of heart failure. Moreover, findings implied that PLN together with its antisense could improve the cardiac functions in murine cardiomyopathy. The complex of relationships between PLN and antisense might provide insights into the PLN research.
There are currently no reviews for this product.
I ask if there is a cleavage site between the GST tag and the protein for item CSB-YP018198HU Recombinant Homo sapiens Cardiac phospholamban.
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFRT