Code | CSB-YP892325HU1 |
Abbreviation | Recombinant Human GDF2 protein, partial |
MSDS | |
Size | $368 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
The recombinant Human GDF2 protein production in Yeast cells involves the integration of a DNA fragment encoding the Human GDF2 protein (300-429aa) into a plasmid vector, which is then introduced into Yeast cells. Following screening, positive cells are cultured and induced to synthesize the GDF2 protein. A N-terminal 6xHis tag is attached to the protein. Cell lysis is carried out to harvest the recombinant Human GDF2 protein, which is purified through affinity purification and then analyzed using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the resulting recombinant Human GDF2 protein reaches over 90%.
There are currently no reviews for this product.
Could you send a price to me for the following below. These will be used on the Biocore so if you can recommend a good purity version, that would be great.
500ug of Human BMP9
HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR