Recombinant Human Laminin subunit beta-1 (LAMB1), partial

In Stock
Code CSB-EP012730HU
Abbreviation Recombinant Human LAMB1 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
CLM; Cutis laxa with marfanoid phenotype; LAM B1; LAMB 1; LAMB1; LAMB1_HUMAN; Laminin B1; Laminin B1 chain; Laminin beta 1 chain; Laminin beta 1 chain precursor; Laminin beta1; Laminin subunit beta 1; Laminin subunit beta-1; Laminin-1 subunit beta; Laminin-10 subunit beta; Laminin-12 subunit beta; Laminin-2 subunit beta; Laminin-6 subunit beta; Laminin-8 subunit beta; LIS5; MGC142015
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1533-1782aa
Target Protein Sequence
MPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.3 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Laminin subunit beta-1 (LAMB1) is produced in E. coli and comprises a partial sequence from amino acids 1533 to 1782, tagged with an N-terminal 6xHis-SUMO tag. The protein exhibits a purity level greater than 85% as determined by SDS-PAGE. This product is intended for research use only.

Laminin subunit beta-1 appears to be a crucial component of the extracellular matrix, playing what seems to be a significant role in cell adhesion, differentiation, and migration. It's part of the laminin family, which is involved in the assembly and stability of basement membranes. Studying LAMB1 may be essential for understanding tissue development and repair processes, making it a potentially valuable target in cellular biology research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Human LAMB1 fragment is expressed in E. coli, a prokaryotic system that is generally unsuitable for producing properly folded eukaryotic extracellular matrix proteins like LAMB1. Laminins require precise folding, disulfide bond formation, and glycosylation for their structural and functional integrity, none of which E. coli can provide adequately. The protein is a partial fragment (1533-1782aa) representing only a small portion of the full-length protein, and contains an N-terminal 6xHis-SUMO tag that may further interfere with proper folding. Since activity is unverified and the expression system is mismatched for this complex eukaryotic protein, the protein is highly likely to be misfolded and inactive without experimental validation.

1. Antibody Development and Validation

This application is appropriate. The recombinant LAMB1 fragment can serve as an effective immunogen for generating antibodies that recognize linear epitopes within the 1533-1782aa region. The tags facilitate purification and screening. However, if the protein is misfolded (as is likely in E. coli), antibodies may not recognize conformational epitopes of native LAMB1 in physiological contexts. It should be noted that validation against full-length, properly folded LAMB1 is essential for physiological relevance.

2. Protein-Protein Interaction Studies

This application is high-risk without folding validation. While the tags enable technical feasibility for pull-down assays, if the LAMB1 fragment is misfolded, it may not interact physiologically with true binding partners. The SUMO tag may improve solubility, but cannot compensate for the lack of proper eukaryotic folding. Identified interactions may be artifactual. This application should not be pursued without prior confirmation of proper folding.

3. Biochemical Characterization and Biophysical Analysis

This application is well-suited and should be prioritized. Techniques like circular dichroism spectroscopy, mass spectrometry, and thermal stability assays can directly assess the protein's folding state and properties. These studies are valuable even if the protein is misfolded, as they characterize the recombinant product itself. These assays are quality control measures rather than functional validation.

4. ELISA-Based Binding Assays

This application is problematic without folding validation. If the LAMB1 fragment is misfolded, binding sites for extracellular matrix components or receptors may be altered or absent, leading to inaccurate binding data. The oriented immobilization via His-tag is technically feasible but does not ensure physiological relevance. This application requires prior validation of proper folding and binding functionality.

Final Recommendation & Action Plan

Given the high probability of misfolding due to E. coli expression and the fragmentary nature of the protein, we recommend first performing a comprehensive biophysical characterization (circular dichroism for secondary structure, size-exclusion chromatography for aggregation state) to assess folding quality. Antibody development can proceed immediately, but resulting antibodies should be validated against native LAMB1 from mammalian sources. Avoid interaction and binding studies until proper folding is confirmed. For reliable LAMB1 functional studies, consider obtaining full-length protein from mammalian expression systems capable of proper folding and post-translational modifications. If misfolding is detected, focus applications on antibody development and biochemical characterization rather than functional assays.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Involved in the organization of the laminar architecture of cerebral cortex. It is probably required for the integrity of the basement membrane/glia limitans that serves as an anchor point for the endfeet of radial glial cells and as a physical barrier to migrating neurons. Radial glial cells play a central role in cerebral cortical development, where they act both as the proliferative unit of the cerebral cortex and a scaffold for neurons migrating toward the pial surface.
Gene References into Functions
  1. High cytoplasmic laminin expression is associated with Oral Squamous Cell Carcinomas. PMID: 29479990
  2. Treatment of Neuroscreen-1 (NS-1) cells with laminin-1 or YIGSR peptide, which corresponds to a sequence in laminin-1 beta1 chain that binds to 67LR, induced a decrease in the cell-surface expression of 67LR and caused its internalization. PMID: 29108990
  3. In vitro activation of PDGFR-alpha leads to translational activation of LAMB1, which in turn induces an invasive and metastatic phenotype of hepatocellular carcinoma cells exhibiting K19 expression. PMID: 28783171
  4. LAMB1 may affect the initiation and progression of pneumoconiosis, or serve as a potential biomarker of pneumoconiosis for diagnosis and genetic susceptibility. PMID: 28444932
  5. LAMB1 is a potential serological biomarker that could be used in conjunction with carcinoembryonic antigen for diagnosis of colorectal cancer. PMID: 26359947
  6. These results suggest that MUC5B production can be regulated by ECM components and that MUC5B is upregulated by fibronectin and laminin via the integrin, ERK, and NF-kappaB dependent pathway. PMID: 26057585
  7. An association was found between LAMB1 rs2158836 polymorphisms and symptom severity in Korean autism spectrum disorder patients. PMID: 25774865
  8. LAMB1 single nucleotide polymorphism rs886774 was associated with early onset Ulcerative colitis and, thus, suggests a fundamentally different mechanism of early disease pathogenesis in Ulcerative colitis versus Crohn's disease. PMID: 25664710
  9. Upregulation of LAMB1 expression was highly correlated with the downregulation of miR-124-5p. LAMB1 protein expression was suppressed by miR-124-5p. PMID: 24497408
  10. The phenotype due to LAMB2 mutations appears to be similar between different ethnic groups. PMID: 23679161
  11. Homozygous deleterious mutations in LAMB1. PMID: 23472759
  12. Laminin beta1 and integrin alpha2 expression is elevated in the anterior temporal neocortex tissue from patients with intractable epilepsy. PMID: 21370991
  13. We did not find an association of rs6949033 (LAMB1) with ulcerative colitis. PMID: 21744425
  14. mRNA encoding laminin-alpha1, -beta1, and -gamma1 chains was expressed in 90% of endometriotic lesions. PMID: 12615822
  15. alteration of LAMB1 expression is associated with the genesis and development of uterine leiomyoma PMID: 15706419
  16. laminin beta1 chain (a constituent of laminin-8) was typically found in vessel walls of carcinomas and their metastases but not in those of normal breast PMID: 15987446
  17. laminin supports platelet adhesion depending on the interaction of VWF and GPIb-IX-V under pathophysiological high shear flow PMID: 18450753
  18. Meningiomas increase in size through increased production of extracellular matrix; furthermore, the proliferation of cells typically associated with neoplasia requires considerable interaction with the extracellular matrix. PMID: 18474427
  19. Elevated expression of laminin beta1 mRNA and protein in the hippocampus suggests that laminin beta1 may play a role in the development of epileptic seizures in patients with intractable epilepsy. PMID: 18691630
  20. beta2 chain-containing laminins (beta2-laminins) bound more avidly to alpha3beta1 and alpha7X2beta1 integrins than beta1 chain-containing laminins (beta1-laminins). PMID: 19147489
  21. The presence of nuclear beta-catenin and high content of mmp-9 in the tumor were associated with abnormal accumulation of laminin in the cytoplasm. These changes were characteristic of colorectal cancer with high invasive metastatic potential. PMID: 19526105
  22. LAMB1 new susceptibility loci for ulcerative colitis PMID: 19915572

Show More

Hide All

Involvement in disease
Lissencephaly 5 (LIS5)
Subcellular Location
Secreted, extracellular space, extracellular matrix, basement membrane. Note=Major component.
Database Links

HGNC: 6486

OMIM: 150240

KEGG: hsa:3912

STRING: 9606.ENSP00000222399

UniGene: Hs.650585

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*