Recombinant Human Metalloproteinase inhibitor 2 (TIMP2), partial

Code CSB-EP023561HU1
Abbreviation Recombinant Human TIMP2 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than ≥ 90% as determined by SDS-PAGE.
Target Names
TIMP2
Uniprot No.
Research Area
Cardiovascular
Alternative Names
CSC 21K; CSC-21K; CSC21K; Metalloproteinase inhibitor 2; Metalloproteinase inhibitor 2 precursor; TIMP 2; TIMP metallopeptidase inhibitor 2; TIMP-2; TIMP2; TIMP2_HUMAN; Tissue Inhibitor of Metalloproteinase 2; Tissue inhibitor of metalloproteinases 2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
30-220aa
Target Protein Sequence
SPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.5kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19.
Gene References into Functions
  1. TIMP-2 may be considered as a potential non-invasive marker for the diagnosis of liver fibrosis in patients with NAFLD. PMID: 30284418
  2. UV-induced expression of DNMT1 may be responsible for mediating DNA hypermethylation in TIMP2, and thus, silencing its expression, in UV-exposed human skin. PMID: 29685765
  3. Overexpression of TIMP2 inhibited cell viability, migration and EMT process. PMID: 29432996
  4. TIMP2 was confirmed to be a direct downstream target of miR616. Inhibition of TIMP2 expression was required for the promoting effects of miR616 on the metastasis and EMT of ovarian cancer cells. PMID: 29658596
  5. TIMP2 promotes tumor progression and miR2055p directly regulates TIMP2, thereby suppressing proMMP2 activation and inhibiting oral squamous cell carcinoma cell invasiveness. PMID: 29393341
  6. Urine levels of TIMP2 (and IGFBP7) are predictive of acute kidney injury following cardiac surgical procedures. PMID: 28803769
  7. MMP-9 and TIMP-2 genes are upregulated in cancerous tissues when compared to normal bladder tissues. PMID: 28980922
  8. Overexpression of MMP2 and MMP16 in endometrial cancerous tissues corresponded to down-regulation of miR-377, miR-382 and miR-410, while decreased expression of TIMP2 was associated with miR-200b up-regulation. PMID: 28871006
  9. MiR-106a was inversely correlated with TIMP2. PMID: 28731196
  10. In squamous cell carcinoma of the cervix (SCCC), higher levels of MMP-14 expression were established in tumor cells, as evidenced by IHC (+3) and RT-PCR.Furin activity in the tumor was much higher than that in normal tissues. The expression of TIMP-2 mRNA was sufficiently obvious in both the tumor and normal tissues to the bottom of the uterine cavity. PMID: 29265076
  11. methylation differences within the TIMP2 gene promoter are not related to patellar tendinopathy PMID: 28888475
  12. This study provides evidence that TIMP-2 is a knee OA susceptibility gene in the Chinese population and a potential diagnostic and preventive marker for the disease. PMID: 27901480
  13. Tissue inhibitor of metallopeptidases 2 (TIMP2) protein and mRNA levels were downregulated after miR-15b overexpression in A549 and LTEP-a-2 cells, respectively. Our results indicate that high expression of miR-15b is associated with non-small cell lung cancer (NSCLC)and suggest that miR-15b expression may be a novel biomarker for predicting clinical outcomes in NSCLC patients PMID: 28498424
  14. study results suggest an association between matrix metalloproteinase 2, matrix metalloproteinase 9 and tissue inhibitor of metalloproteinase 2 single nucleotide polymorphisms with sperm parameters, but not infertility PMID: 27401679
  15. Long noncoding RNA DANCR promotes prostate cancer invasion and metastasis through repressing the expression of TIMP2/3 PMID: 27191265
  16. MMP2-1306C/T and TIMP2-418 G/C gene variants as risk factors for patients with relapsing remitting multiple sclerosis, was studied. PMID: 27174941
  17. biomarker for acute kidney injury PMID: 27174659
  18. epithelial cells and leukocytes from the urinary sediment. CONCLUSION: The gene expression pattern of IGFBP7 and TIMP-2 from urinary sediment, which contains desquamated renal tubular epithelial cells, did not correlate with [IGFBP7]x[TIMP-2] protein, indicating that IGFBP7 and TIMP-2 measured in the NephroCheck(R) test originated predominantly from intact but stressed cells of the kidney itself PMID: 29145491
  19. This study demonstrated that TIMP2 higher expression in glioblastoma PMID: 27633774
  20. Data show that tissue inhibitor of metalloproteinase 2 (TIMP2) is a direct target of miR-492 that modulates cervical cancer cell invasion. PMID: 28802022
  21. A higher risk of incidence or recurrent depressive disorder(OR=9.376) was confirmed in the case of a set of T/T-G/C genotypes of the MMP-9T-1702A and TIMP-2G-418C polymorphisms PMID: 27434116
  22. High TIMP2 expression is associated with acute kidney injury. PMID: 27342580
  23. expression of TIMP2 was inversely associated with miR-106a in nodule tissues. Apoptotic body was also seen under electron microscope accompanied by silencing of miR-106a. Together, this data indicated that miR-106a may act as an oncogene and contribute to gastric cancer development. PMID: 27142596
  24. Urine [TIMP-2]*[IGFBP7] is a promising candidate for early detection of AKI, especially in ruling-out AKI PMID: 28107490
  25. We conclude that in the resected esophageal cancer an increased mRNA expression of MMP-7, MMP-10 and TIMP-1 correlated with clinicopathologic features. We suggest that these genes may play a role during progression of the disease. MMP-10, MMP-7, TIMP-1, TIMP-2 were overexpressed in 73%, 85%, 55% and 42% of esophageal cancer samples, respectively. PMID: 28510611
  26. At hospital admission, all viral gastroenteritis (GE) patients viral gastroenteritis (GE) patients demonstrated increased MMP-9 and decreased MMP-2 and TIMP-2 serum levels; kinetics of serum MMP-2, MMP-9, and TIMP-2 levels were similar among the viral GE patients but distinct from bacterial enteritis patients; involvement of MMPs and TIMPs in the pathophysiology of gastrointestinal symptoms likely varies depending on the PMID: 26765397
  27. Meta-analysis indicated that urinary [TIMP-2].[IGFBP7] may be a reliable biomarker for the early detection of acute kidney injury in adults. PMID: 28682920
  28. Results show that resistant hypertension was associated with higher TIMP-2 levels and low MMP-2/TIMP-2 ratio, suggesting that these regulators of ECM remodeling play a key role in blood pressure control in this high-risk subset of hypertensive individuals. PMID: 27412873
  29. important regulator of extracellular matrix degradation and hepatocellular carcinoma metastasis PMID: 27018975
  30. TIMP-2 is both expressed and secreted preferentially by cells of distal tubule origin, while IGFBP7 is equally expressed across tubule cell types yet preferentially secreted by cells of proximal tubule origin. In human kidney tissue, strong staining of IGFBP7 was seen in the luminal brush-border region of a subset of proximal tubule cells, and TIMP-2 stained intracellularly in distal tubules. PMID: 28003188
  31. Myopia development in mammals is associated with reduced expression of TIMP-2, which contributes to increased degradative activity in the sclera. PMID: 28384717
  32. our results revealed miR-483-5p directly targeted to the cartilage matrix protein matrilin 3 (Matn3) and tissue inhibitor of metalloproteinase 2 (Timp2) to stimulate chondrocyte hypertrophy, extracellular matrix degradation, and cartilage angiogenesis, and it consequently initiated and accelerated the development of OA. PMID: 28139355
  33. Stromal TIMP-2 expression reflected its role in regulating tumor progression in ameloblastoma and in regulating developmental processes in tooth germs by their inhibitory effect on MMP-9 PMID: 26067137
  34. No significant differences were found between MMP-7 A-181G, C-115T, and TIMP-2 G-418C polymorphism and coronary artery disease and myocardial infarction in a Turkish population. PMID: 28137415
  35. High TIMP2 expression is associated with chronic myelogenous leukemia. PMID: 28035415
  36. MMP-2 and TIMP-2 were secreted by both tumor cells and stromal cells. PMID: 27853937
  37. that miR-22 acts to regulate invasion of 1321N1 astrocytoma cells by targeting TIMP2 expression PMID: 27834627
  38. Results show decreased expression of MMP-2, MMP-9 and TIMP-2 genes on both mRNA and protein levels in depression; there elevated expression positively affects cognitive efficiency. PMID: 26856768
  39. TIMP- 2 expression decreased in cervical disc herniation patients. PMID: 27173256
  40. Changes in MMPs and TIMP expression may be a common element in, or perhaps even a marker for, recurrent depressive disorders and somatic diseases. PMID: 27098106
  41. quantitative urine test is available to assess the risk of developing AKI by measuring the concentrations of two protein biomarkers, TIMP-2 and IGFBP-7 PMID: 26797672
  42. miR-22 significantly upregulated the invasion capacity of 1321N1 cells. In silico analysis predicted that TIMP2 is a target gene of miR-22 which was confirmed by qPCR and Western blotting. Luciferase reporter assays demonstrated that miR-22 directly bound the 3'-untranslated regions of TIMP2. These data suggest that miR-22 acts to regulate invasion of 1321N1 astrocytoma cells by targeting TIMP2 expression. PMID: 27834627
  43. Pathogenesis and progression of nasal polyps is closely related with elevated MMP-9 and suppressed TIMP-2 expression PMID: 26823777
  44. our results demonstrate that TIMP-2 stimulates lung adenocarcinoma cell proliferation PMID: 26556867
  45. new evidence that promoter polymorphisms in TIMP2 are functional and may affect gene transcription with possible effects on craniofacial development leading to NSCL/P. PMID: 24799419
  46. This study shows that urinary [TIMP-2]*[IGFBP7] has a good diagnostic performance in predicting adverse outcomes in neonatal and pediatric AKI of heterogeneous etiology. PMID: 26606754
  47. showed a significant association between the variants of MMP-2 and TIMP-2 promoters and spontaneous intracerebral hemorrhage PMID: 26551785
  48. TIMP2 is elevated in patients with non-alcoholic fatty liver disease. PMID: 26329758
  49. TIMP-2 interaction with MT1-MMP provides tumor cells with either pro- or anti-apoptotic signaling depending on the extracellular environment and apoptotic stimulus. PMID: 26331622
  50. MiR-761 directly targeted ING4 and TIMP2. PMID: 26278569

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Protease inhibitor I35 (TIMP) family
Database Links

HGNC: 11821

OMIM: 188825

KEGG: hsa:7077

STRING: 9606.ENSP00000262768

UniGene: Hs.633514

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*