Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
AG2S; Agtr 1; Agtr1; AGTR1_HUMAN; Agtr1a; AGTR1B; Ang II; Angiotensin II receptor type 1; Angiotensin II type-1 receptor; Angiotensin receptor 1; Angiotensin receptor 1B; AT 1B; AT 1r; AT1; At1a; AT1AR; AT1B; AT1BR; AT1R; AT2R1; AT2R1A; AT2R1B; HAT1R; Type 1 angiotensin II receptor; Type 1B angiotensin II receptor; Type-1 angiotensin II receptor
Species
Homo sapiens (Human)
Expression Region
297-359aa
Target Protein Sequence
LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The preparation of Recombinant Human AGTR1 protein included 3 main steps: construct the expression vector, expression of protein of interest, and protein purification. Every step was performed under a strict QC system so that we got the premium protein. This AGTR1 was expressed in Yeast at and fused with N-terminal 6xHis tag. According to SDS-PAGE, the purity turns out to be 90%+.
AGTR1 encodes the angiotensin II (Ang II) type I receptor that belongs to the family of G-protein coupled receptors. AGTR1 is an important part of the Renin-angiotensin system (RAS). AGTR1 has a strong influence on tumor growth, angiogenesis, inflammation, and immunity. Hypomethylation in the AGTR1 promoter had been validated to be inversely correlated with uric acid levels, which can be a significant risk predictor of essential hypertension (EH). Besides, AGTR1 methylation had been extensively studied in human cancers, such as oral squamous cell carcinoma. For example, a study showed that AGTR1 mediates breast cancer metastasis by regulating CXCR4/SDF-1α. Another study showed that AGTR1 promotes the invasion of breast cancer. Based on the pan-cancer analysis, researchers found that the expression of AGTR1 in most tumor tissues, including lung cancer, was significantly lower than the corresponding normal tissues and was related to prognosis.