Recombinant Human Type-1 angiotensin II receptor(AGTR1),partial

Code CSB-YP001465HU
Size US$1916
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The Latest Promotion
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names AGTR1
Uniprot No. P30556
Research Area Cancer
Alternative Names AG2S; Agtr 1; Agtr1; AGTR1_HUMAN; Agtr1a; AGTR1B; Ang II; Angiotensin II receptor type 1; Angiotensin II type-1 receptor; Angiotensin receptor 1; Angiotensin receptor 1B; AT 1B; AT 1r; AT1; At1a; AT1AR; AT1B; AT1BR; AT1R; AT2R1; AT2R1A; AT2R1B; HAT1R; Type 1 angiotensin II receptor; Type 1B angiotensin II receptor; Type-1 angiotensin II receptor
Species Homo sapiens (Human)
Source Yeast
Expression Region 297-359aa
Target Protein Sequence LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 9.2kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. Intracrine action of angiotensin II in mesangial cells: subcellular distribution of angiotensin II receptor subtypes AT1 and AT2. PMID: 29455433
  2. Meta-analysis suggests that AGTR1 A1166C polymorphism may increase the susceptibility to diabetic nephropathy. PMID: 30313019
  3. Results may indicate that the choice of diet can undermine the potential genetic risk of the AT1R 1166A>C polymorphism for MetS, and persons who are variant carriers may spontaneously choose the Mediterranean diet. PMID: 30205174
  4. The research reveals that among patients with essential hypertension treated with hypotensive drugs there are certain relationships between the rs5182 and rs5186 polymorphisms of the AGTR1 gene, as well as between the rs1799998 polymorphism of the CYP11B2 gene and the volume of the carotid bodies. PMID: 29627490
  5. The protective effects of short-term hypoxia (STH) are associated with the upregulation of MasR to inhibit AT1 R signaling. STH could be a potential therapeutic strategy for cardiac diseases in hypertensive patients. PMID: 29052864
  6. A high level of ART1 antibodies was a risk factor for allograft function in kidney transplant recipients. PMID: 29507275
  7. we found an interaction between ACE2 and AGTR1 in structuralatrial fibrillation patients in a Chinese Han population PMID: 29441892
  8. AGTR1 DNA hypomethylation is a risk factor for the development of hypertension. Furthermore, there is a correlation between smoking, diet, and AGTR1 DNA methylation levels. PMID: 28376480
  9. Chinese Han persons with C allele of rs9817428 in PPARG gene were related to the increased risk of hypertension. PMID: 29266977
  10. Association of AGTR1 single nucleotide polymorphism rs275645 and pre-eclampsia in Chinese population. PMID: 27910864
  11. although the present study did not find any association between AGTR1 A1166C polymorphism and the risk of systemic lupus erythematosus, the presence of this polymorphism was associated with higher levels of malondialdehyde and higher concentration of neopterin PMID: 28530466
  12. We conclude that the crosstalk between angiotensin AT1 receptor and insulin receptor signaling shows a high degree of specificity, and involves Galphaq protein, and activation of distinct kinases. Thus, the BRET(2) technique can be used as a platform for studying molecular mechanisms of crosstalk between insulin receptor and 7TM receptors. PMID: 28854843
  13. The AGTR1-mediated cell apoptosis was suppressed by overexpressing miR-1248 and inhibited protein translation of AGTR1 by miR-1248, through binding to the 3'-UTR of the AGTR1 mRNA. PMID: 29482191
  14. The effects ofgenetic polymorphisms and diet on the risk of metabolic disorders predisposing to cardiovascular diseases among Malay, Chinese, and South Asian persons are reported. PMID: 28792482
  15. AGTR1 gene, related to renin-angiotensin system, might play momentous roles in the initiation and development of consecutive Trauma-Induced Sepsis. PMID: 29642183
  16. The genotypes of REN, AT1R and AT2R were not associated with the development of preeclampsia in South African Black women. PMID: 28641212
  17. AC-CC genotype of AT1R and noise were the risky factors of EH. These factors also interacted with each other. PMID: 28157766
  18. the A1166C polymorphism in the AGTR1 gene may not be a risk factor for breast cancer (Meta-Analysis) PMID: 26634463
  19. High levels of AT1R is associated with angiogenesis in bladder cancer. PMID: 28599664
  20. High angiotensin II type 1 receptor antibodies are associated with graft rejection in renal transplantation. PMID: 26546592
  21. No statistically significant data on the correlation between the AGTR1 A/C polymorphism and the development of Atrial Fibrillation were obtained in any patient subgroup of a Siberian population. PMID: 29039830
  22. Letter/Case Report: refractory vascular rejection in a hand transplant recipient in the presence of AGTR1 antibodies. PMID: 28767535
  23. These findings suggest that AT1R overexpression is an independent adverse prognosticator for patients with esophageal squamous cell carcinoma PMID: 27564102
  24. As previously found for rs1799752 in ACE, rs5186 in AGTR1 was associated with dementia at baseline. These associations became substantially weaker, or disappeared, when dementia onset to 2012 was included. PMID: 27639288
  25. Study identified the first significant associations between SNPs rs275651, rs275652 and rs4524238 in AGTR1 gene and high-altitude pulmonary edema susceptibility. PMID: 27732943
  26. There was no association for rs5186 with LVH under any of models. PMID: 28513230
  27. Homocysteine displaces angiotensin II and regulates the conformation of the AT1 receptor. PMID: 29296021
  28. no statistical association with kidney graft failure was found for anti-AT1R antibodies, indicating that these tests may not be the best predictors of graft outcome in living donor renal transplantation. PMID: 28372986
  29. Inhibition of CaV1.2 upregulates AT1R signaling in response to angiotensin II. PMID: 28514967
  30. Single nucleotide polymorphisms of AGTR1 gene are associated with Hypertension. PMID: 27045027
  31. The presence of AGTR1 autoantibodies is an independent predictor for aortic stiffness progression in normotensive subjects. PMID: 29097625
  32. The DEGs, such as AGTR1, CYP3A4 and CYP4A11 may play critical roles in the development of HTN likely via the regulation by hsa-miR-26b-5p and taking part in some pathways. PMID: 27756246
  33. Low shear stress induces the generation of endothelial reactive oxygen species via AT1R/eNOS/NO signaling pathway. PMID: 28518223
  34. Low AGTR1 expression is associated with chemoresistance of osteosarcoma. PMID: 28073349
  35. No relationship was found between the studied polymorphisms (14094 ACE gene, rs1800469 gene TGFbeta1, GNB3 gene rs5443, rs5186 AGTR1 gene) and the occurrence of primary vesicoureteral reflux. PMID: 27988909
  36. Angiotensin II type 1 receptors promote ADAM17-mediated ACE2 shedding in the brain of hypertensive patients. PMID: 28512108
  37. Data suggest that allosteric communication between heterodimeric AT1R and PTGFR is mediated through GNAQ and may also involve proximal phospholipase C but not distal protein kinase C signaling partners; PTGFR activation has negligible effects on AT1R-based conformational biosensors. (AT1R = angiotensin II receptor, type 1; PTGFR = prostaglandin F2alpha receptor; GNAQ = GTP-binding protein G[q] subunit alpha) PMID: 28584054
  38. our results show the pivotal mechanisms of AT1R-induced harmful phenotype of Plasmodium-specific CD8(+) T cells during blood-stage malaria. PMID: 28261571
  39. Ouabain stimulates NKA in renal proximal tubule cells through an angiotensin/AT1R-dependent mechanism and that this pathway contributes to cardiac glycoside associated hypertension. PMID: 27496272
  40. Mutations within transmembrane domains IV, V, VI, and VII had no effect on angiotensin-mediated beta-arrestin1 recruitment; however, they exhibited differential effects on the assembly of AT1R into oligomeric complexes. PMID: 28096461
  41. Our findings provide evidence that induction of APP shedding via Ang II/AT1 receptor stimulation is effected by G protein activation with Gbg subunits playing important roles. PMID: 28102934
  42. highly and selectively expressed in colonic L cells PMID: 27447725
  43. AT1R-Ab and anti-endothelial cell antibodies may identify patients at higher risk for antibody mediated injury, particularly in the presence of HLA-donor specific antibodies. PMID: 27222934
  44. Structure and Function of Cross-class Complexes of G Protein-coupled Secretin and Angiotensin 1a Receptors. PMID: 27330080
  45. studied the clinical significance of the AT1RA1166C receptor polymorphism and its relationship with serum concentration of lipids, oxidant/antioxidant systems and vascular adhesion protein-1(VAP-1) in 100 psoriatic patients and 100 gender- and age-matched unrelated healthy controls from west population of Iran PMID: 26395033
  46. angiotensin II Type 1 receptor genotype may influence the clinical expression of vasculopathy in systemic sclerosis patients. PMID: 27488275
  47. Single nucleotide polymorphisms (SNP) in angiotensin II receptor, type 1 (AGTR1), transcription factor AP-2 beta (TFAP2B), and tumor necrosis factor receptor-associated factor 1 (TRAF1) have been reported to be associated with the incidence of PDA in preterm infants. PMID: 26615960
  48. AGTR1 rs3772622 gene polymorphism was not associated with the risk of developing non-alcoholic fatty liver disease (NAFLD), but could increase the risk of NAFLD patients suffering from coronary artery disease in the Chinese Han population. PMID: 27342049
  49. Results demonstrated that rs1492099, a SNP of AGTR1 gene, could be a potential genetic risk factor of arterio-venous fistula malfunction in male hemodialysis patients. PMID: 27240348
  50. Median total Angiotensin II type 1 receptor IgG concentration was significantly higher in the stable pediatric kidney transplant group as compared to the adult transplant group. For both groups, the transplant group showed higher levels than the control group. PMID: 27251358
  51. ACE I/D is associated with Abdominal Aortic Aneurysm , and 1166A>C AT1R with the size of the aneurysm, while -1562C>T MMP-9 and CCR5Delta32 polymorphisms are most probably not associated with Abdominal Aortic Aneurysm in Croatian patients. PMID: 27533781
  52. AT1R A1166C polymorphism impacts an ultrasonographically-defined human plaque phenotype, with intra-plaque AT1R and miR-155 expression altered in advanced carotid atherosclerosis PMID: 27016615
  53. Transgenic mice containing Hap-I and Hap-II of the human AT1R gene in a 166-kb bacterial artificial chromosome were generated. Mice containing Hap-I suffered from significantly higher neurological deficits and larger brain infarcts than Hap II. Increased expression of hAT1R rendered Hap-I TG mice susceptible to stroke-related pathology. PMID: 25652270
  54. Epigallocatechin-3-gallate inhibits Ang II-induced CRP generation by interfering with AT1-ROS-ERK1/2 signal pathway in hepatocytes, preventing inflammation. PMID: 27492718
  55. CAV-1, FOXM1 and AT1-R may be potential markers of tumorigenesis in certain types of cancer in vitro. PMID: 27213551
  56. no correlation was established between the occurrence of CHD and AGTR1 haplotypes present at frequencies greater than 3%. PMID: 27050965
  57. peripheral and central arterial pressures and pulse wave augmentation indexes (AIx(P), AIx(C1), AIx(C2)), pulse wave velocity (PWV), daily urinary sodium excretion were measured and did genetic studies of AGTR1 A1166C and AGTR2 G1675A polymorphisms. PMID: 27339867
  58. Monocytes of patients with systemic sclerosis presented an increased angiotensin II Type 1 receptor (AT1R)/AT2R ratio compared with those of healthy donors. PMID: 26773103
  59. These data suggest that AT2R inhibits ligand-induced AT1R signaling through the PKC-dependent pathway. PMID: 26857745
  60. AGTR1 was found to have undergone natural selection in Euro-Asian populations that predisposes Chinese populations to essential hypertension. PMID: 26901789
  61. The results of this study indicated that the ACE gene polymorphism was associated with an increased risk of PHDs, whereas the eNOS and AT1R gene polymorphism only have increased susceptibility to PHDs in part of the gene models. PMID: 26119526
  62. AT1 A1166C polymorphism may play significant role in conferring genetic susceptibility of LVD. PMID: 26138177
  63. No difference in the overall post-heart transplant survival and freedom from acute cellular and antibody-mediated rejection between anti-AT1R-negative and anti-AT1R-positive Heart Mate II bridged recipients. PMID: 26675563
  64. The AGTR1 gene A1166C polymorphism may not be correlated with IgA nephropathy susceptibility. PMID: 26782590
  65. This meta-analysis suggests that A1166C polymorphism in the AT1R gene is associated with the risk of hypertension in Asian and Caucasian populations. PMID: 25990648
  66. Ten tagging single nucleotide polymorphisms on AGTR1/AGTR2 were genotyped for all subjects with primary aldosteronism and controls. PMID: 25172908
  67. AT1R gene A1166C polymorphism was associated with reduced risk for breast cancer. PMID: 26041128
  68. AT1R mRNA is regulated by TIA-1 in a ER stress-dependent manner. PMID: 26681690
  69. the majority of Angiotensin II Type I receptors in the rat RVLM are located on non-C1 neurons or glia PMID: 26138553
  70. Our findings indicate that epidermal growth factor, interleukin-1beta and angiotensin II receptor, type 1 may play important roles in the pathogenesis of endometriosis. PMID: 26366788
  71. Data suggest that CpG dinucleotides CpG1 hypomethylation in the angiotensin II type 1 receptor (AGTR1) promoter is likely associated with the risk of essential hypertension (EH) in the population assessed. PMID: 26658476
  72. We concluded that the AT1R genotype does not contribute to the genetic susceptibility of ESRD and is not associated with progression of chronic kidney failure to ESRD. PMID: 25316403
  73. Findings suggest that angiotensin II type I receptor (AGTR1) plays a significant role in tumor aggressiveness, and its inhibition may have therapeutic implications. PMID: 26975580
  74. These results suggest that AT1-AA is able to cause amplification response to Ang II probably via the calcium-independent protein kinase C pathway, which may provide a new therapy strategy for preeclampsia. PMID: 26350097
  75. rs387967 is associated with the susceptibility to essential hypertension in a Yi population and the tendency was replicated in systolic blood pressure and diastolic blood pressure detection. PMID: 25628312
  76. Ang-(1-7) downregulated AT1R mRNA, upregulated mRNA levels of Ang II type 2 receptor (AT2R) and Mas receptor (MasR) and p38-MAPK phosphorylation and suppressed H22 cell-endothelial cell communication PMID: 26225830
  77. our study indicated that the A1166C polymorphism in AT1R may be not associated with an increased risk of HF. PMID: 26345849
  78. CC AT1R genotype was associated with deteriorated endothelial functions in the target vessels of PCI and intermediate to long-term in-stent restenosis. PMID: 26261635
  79. Adiponectin +276 G/T and AGTR1 A1166C single-nucleotide polymorphism are likely to be risk factors for BRVO. PMID: 25932559
  80. Autoantibodies against the angiotensin AT1 receptor increase in unstable angina patients after stent implantation and may play role in coronary restenosis. PMID: 25025993
  81. Our results suggest that silencing of AT1R inhibits EMT induced by HG in HK-2 cells via inactivation of mTOR/p70S6K signaling pathway. PMID: 26626074
  82. analysis of crystal structure of the human AT1R in complex with an inverse agonist olmesartan (Benicar(TM)), a highly potent anti-hypertensive drug PMID: 26420482
  83. PPARG rs1152002, AGTR1 rs5186, CXCL16 rs3744700 and LGALS2 rs7291467 polymorphisms may be closely related to the development of coronary heart disease PMID: 26045830
  84. the AT1R Al166C polymorphism was significantly associated with the pregnancy-induced hypertension, especially in Asian subjects (Meta-Analysis) PMID: 26524813
  85. AT1R A1166C gene polymorphism was not associated with Immunoglobulin A nephropathy susceptibility in Asian population. PMID: 25585948
  86. ATR-1-autoantibodies can cause acute graft rejection. PMID: 25936314
  87. This study seems to suggest that c.1-361A > T, c.1-254C > G and c.1-218C > T polymorphisms in TRPC6 gene and c.1166A > C polymorphism in AGTR1 could have a role in the development of this disease. PMID: 25603901
  88. AngII/AT1/Nox4 axis-mediated oxidative stress gives rise to the dopamine neuron dysfunction and loss characteristic of the neuropathological and clinical manifestations of PD. PMID: 25645462
  89. AngII regulated the mRNA expression of AT1 in the melanocytes. These results provide a novel insight into the role of AngII and its associated signaling in melanogenesis. PMID: 25760379
  90. pIgA-activated human mesangial cells up-regulates angiotensin II receptor subtype 1 and prorenin receptor expression by podocytes and the associated activation of NFkappaB and notch signalling pathways play an essential role in the podocytic apoptosis. PMID: 25808596
  91. Patients with the ACE DD genotype plus 1 or 2 unfavorable genotypes, the AT1R No-AA, the GPIIIa No-a1a1 or a combination of both, have twice higher the risk of MACE during their clinical follow-up. PMID: 23990179
  92. Case Report: non HLA sensitized male renal allograft recipient who developed acute vascular rejection in the presence of elevated angiotensin II type 1 receptor antibodies. PMID: 25807851
  93. Our findings indicate that the AT1R gene 1166C allele and the AC/CC genotypes were positively associated with the pregnancy hypertensive disorde{REVIEW} PMID: 23223091
  94. AT1R antibodies may play a significant role in antibody-mediated renal graft rejection without detectable donor-specific HLA antibodies. PMID: 25891704
  95. AT1 receptor expression was associated to enhance angiogenesis and cellular proliferation rate, but no relationship with AT2 was found PMID: 25682288
  96. Higher expression of AT1R gene was observed in patients with CC genotype than with AC and AA genotypes. PMID: 24992666
  97. AC and CC genotypes of angiotensin II type I receptor A1166C polymorphism were significantly high among the total as well as female hypertensives PMID: 25572238
  98. findings suggest a role for agonistic autoantibodies-induced activation of immune cells mediated by the AT1R and the ETAR in the pathogenesis or even the onset of systemic sclerosis PMID: 24612997
  99. Identification of Distinct Conformations of the Angiotensin-II Type 1 Receptor Associated with the Gq/11 Protein Pathway and the beta-Arrestin Pathway Using Molecular Dynamics Simulations. PMID: 25934394
  100. No statistically significant difference was found for the ACE and AT1R gene polymorphisms distribution in patients with type 1 diabetes mellitus. PMID: 25109108

Show More

Hide All

Involvement in disease Renal tubular dysgenesis (RTD)
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Liver, lung, adrenal and adrenocortical adenomas.
Database Links

HGNC: 336

OMIM: 106165

KEGG: hsa:185

STRING: 9606.ENSP00000273430

UniGene: Hs.477887

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1