Recombinant Mpuse Interleukin-2 receptor subunit beta(Il2rb),partial

In Stock
Code CSB-YP011650MO
Product Type Recombinant Protein
Size US$2474Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P16297
Lead Time 3-7 business days
Relevance Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias High affinity IL-2 receptor subunit betap70-75; CD122
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
Research Area Others
Source Yeast
Gene Names Il2rb
Protein Names High affinity IL-2 receptor subunit betap70-75; CD122
Expression Region 27-240aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 27.0 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Type I cytokine receptor family, Type 4 subfamily
Database Links

KEGG: mmu:16185

STRING: 10090.ENSMUSP00000086820

UniGene: Mm.35287

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
Endocytosis

Related Products

Il2rb Antibodies

Il2rb Antibodies for Mouse

Il2rb Proteins

Il2rb Proteins for Mus musculus (Mouse)

Il2rb ELISA Kit

Il2rb ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.