Name: Recombinant Mouse Interleukin-2 receptor subunit beta(Il2rb),partial
Brand: CUSABIO
SKU: CSB-EP011650MO1

Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	l2rb
Uniprot No.	P16297
Research Area	Others
Alternative Names	Il2rbInterleukin-2 receptor subunit beta; IL-2 receptor subunit beta; IL-2R subunit beta; IL-2RB; High affinity IL-2 receptor subunit beta; p70-75; CD antigen CD122
Species	Mus musculus (Mouse)
Source	E.coli
Expression Region	24-240aa
Target Protein Sequence	ASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	29.0kDa
Protein Length	Extracellular Domain
Tag Info	N-terminal 6xHis-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Data

Function	Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
Gene References into Functions	The larger pool of IL-2Rbeta chains in CD8+ T cells is required to sustain IL-2 signaling and contributes to the quantitatively greater proliferative response to IL-2 relative to that of CD4+ mouse primary T cell cultures. PMID: 29259099 Diabetes was accelerated in male and female NOD mice in which IL-2Rbeta signaling was modestly and selectively reduced in T cells. PMID: 29259102 c-REL, but not IkappaBNS, controlled the generation of classical CD25(+)Foxp3(-) precursors via direct binding to the Cd25 locus; propose that CD4(+)GITR(+)CD122(+)CD25(-)Foxp3(-) cells represent a Treg pre-precursor population, whose transition into Treg precursors is mediated via c-REL PMID: 28652399 Renal lesions are indeed modulated by intrinsic glomerular cells through the gamma-C/IL-2-beta receptor response, to date classically described only in immune cells. PMID: 28111009 CBP physically associates with the IL-2 receptor beta-chain. CBP, found in the nucleus in resting CTLL-2 cells, relocates to the cytoplasm after IL-2 stimulation in an MEK/ERK pathway-dependent manner. Thus, IL-2-mediated acetylation plays an important role in the modulation of cytokine signaling and T cell fate. PMID: 27799311 IL-2Rbeta-dependent signaling and CD103 functionally cooperate to maintain tolerance in the gut mucosa. PMID: 25527788 Thymic development of CD4+Foxp3+ regulatory T cells (Tregs) is highly dysregulated in IL-2 receptor (2Rbeta)-deficient mice. PMID: 23315074 CDCD11c+B220+CD122+ cells play an important role in xenograft rejection. Their absence in NOG mice may be critical in supporting the successful engraftment of xenotransplants. PMID: 23018460 This study demonstrated that IL-12 signaling plays a complex role during the induction of tolerance as the presence of exogenous IL-12 and the lack of IL-12 signaling both prevent complete induction of tolerance. PMID: 22522341 Continuous activation of the CD122/STAT-5 signaling pathway characterize regulatory lineage differentiation in the murine thymus. PMID: 21541329 Knockout mice exhibited deficit in prepulse inhibition of acoustic startle reflex, significant reductions in acoustic startle reactivity, and modest differences in behavior in elevated plus-maze test. (IL-2/15 receptor-beta) PMID: 11864627 role of the interleukin-2 receptor beta chain region between the two Stat5 docking sites in induction of interleukin-2 receptor alpha expression by interleukin-2 PMID: 12231477 Depletion of IL-2 in vivo induces memory CD8+ T cell division by an IL-15-independent but by an IL-2/15 receptor beta-dependent mechanism, implying a novel process for antigen-independent homeostasis of memory CD8+ T cells in vivo. PMID: 15528339 This study for the first time delineates the molecular mechanisms underlying regulation of mouse IL-2Rbeta gene transcription by Ets family proteins, partially with Egr-1, and thereby further elucidates the molecular basis of lymphocyte activation. PMID: 15752766 The multivesicular regions were present in the cap structure of these granules, suggesting that the uNK cells of the Tg2Rbeta mice had cytotoxic activity. PMID: 16127247 these cells make up a specialized subset of central memory T cells with distinguishable phenotypic characteristics, most notably the higher expression of CD122 and CD127 PMID: 16920913 STAT5 binds to the promoter of the foxp3 gene suggesting that IL-2Rbeta-dependent STAT5 activation promotes Treg differentiation by regulating expression of foxp3. PMID: 17182565 a signal mediated by IL-2Rbeta is essential for the development and homeostasis of Foxp3(+) Treg in vivo PMID: 17559173 local blockade of the beta-chain of the IL-2R restored an immunosuppressive cytokine milieu in the lung that ameliorated both inflammation and airway hyperresponsiveness in experimental allergic asthma PMID: 18641329 Common gamma-chain binding-dependent activation of the shared IL-15/IL-2 receptor beta/common gamma signaling pathway may play an important role in the activation of natural killer (NK) cells and CD8-positive T cells, resulting in tumor growth inhibition. PMID: 19050240 IL-9Ralpha and IL-2Rbeta homodimers efficiently mediate constitutive activation of ALL-associated JAK1 mutants. PMID: 19139102 subset of IL-2-dependent targets is indexed to a low IL-2R signaling threshold PMID: 19185518 A population of memory CD8 T cells generated under sterile inflammatory conditions is identified by intermediate expression levels of CD122/CD44 and is involved in recall contact hypersensitivity reactions responsible for allergic contact dermatitis. PMID: 19265164 IL2R beta-chain induces growth potential for glandular epithelial cells and an immune-privileged condition mediated by CD25+regulatory-T cells. PMID: 19293560 Show More Hide All
Subcellular Location	Membrane, Single-pass type I membrane protein
Protein Families	Type I cytokine receptor family, Type 4 subfamily
Database Links	KEGG: mmu:16185 STRING: 10090.ENSMUSP00000086820 UniGene: Mm.35287

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-EP011650MO1
Size	US$2466
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP011650MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) l2rb. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP011650MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) l2rb.
The Latest Promotion
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Interleukin-2 receptor subunit beta(Il2rb),partial

Product Details

Related Products

Target Data

Most popular with customers

CloseMessage

×CloseMessage