Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP011650MO1 |
| Product Type | Recombinant Protein |
| Size | US$2466 |
| Uniprot No. | P16297 |
| Relevance | Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | High affinity IL-2 receptor subunit betap70-75; CD122 |
| Species | Mus musculus (Mouse) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | ASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE |
| Research Area | Others |
| Source | E.coli |
| Gene Names | l2rb |
| Expression Region | 24-240aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 29.0kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. |
| Subcellular Location | Membrane, Single-pass type I membrane protein |
| Protein Families | Type I cytokine receptor family, Type 4 subfamily |
| Database Links |
KEGG: mmu:16185 STRING: 10090.ENSMUSP00000086820 UniGene: Mm.35287 |
| Pathway |
Jak-STAT signaling pathway
PI3K-Akt signaling pathway Th1 and Th2 cell differentiation Th17 cell differentiation Endocytosis |
l2rb Antibodies for Mouse
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA011650LB01MO | Il2rb Antibody, HRP conjugated | Mouse | ELISA |
| CSB-PA011650LA01MO | Il2rb Antibody | Mouse | ELISA |
| CSB-PA011650LC01MO | Il2rb Antibody, FITC conjugated | Mouse | ELISA |
| CSB-PA011650LD01MO | Il2rb Antibody, Biotin conjugated | Mouse | ELISA |
l2rb Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP011650MO | Recombinant Mpuse Interleukin-2 receptor subunit beta(Il2rb),partial | Yeast |
| CSB-BP011650MO1 CSB-MP011650MO |
Recombinant Mouse Interleukin-2 receptor subunit beta(Il2rb),partial | Baculovirus Mammalian cell |
l2rb ELISA Kit for Mus musculus (Mouse)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E07438m | Mouse Interleukin-2 receptor subunit beta (Il2rb/CD122) ELISA Kit | Request Information |
Recombinant Mouse Vascular endothelial growth factor C(Vegfc)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Rat Plasma kallikrein(Klkb1),Partial
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Cat Serum amyloid A protein(SAA1),partial
Express system: E.coli
Species: Felis catus (Cat) (Felis silvestris catus)
Recombinant Dog Cholinesterase(BCHE)
Express system: E.coli
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Recombinant Human Casein kinase I isoform epsilon(CSNK1E)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Eukaryotic translation initiation factor 3 subunit E(EIF3E)
Express system: E.coli
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
