Code | CSB-EP011650MO1 |
Size |
US$2466Purchase it in Cusabio online store (only available for customers from the US) |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
Interleukin-2 receptor subunit beta/Il2rb CSB-EP011650MO1 is a recombinant partial-length protein containing the extracellular domain (24-240aa) of mouse Il2rb. This protein was fused with a 6xHis-tag at the N-terminus and expressed in E.coli. Its identity was validated by LC-MS/MS analysis. Its purity is greater than 90% determined by SDS-PAGE. A molecular weight band of about 30kDa was visualized on gel under reducing conditions. The recombinant Il2rb protein may find applications in specific antibody production and signal transduction associated with IL2rb. IL2rb, also called CD122, is the IL-2R β-chain, which is shared with IL-15R. Upon T-cell activation, IL-2Rα (CD25) is rapidly induced and help IL2rb and IL-2Rγc (CD132) come closer, constituting an intermediate affinity receptor that is sufficient to elicit the IL2 signaling pathways. signaling through IL2rb is indispensable for the differentiation and function of cells and NK cells. Xiaomei Yuan etc. demonstrated that IL2rb blockade preferentially affected major populations of islet-associated pathogenic cells by reducing their abundance and suppressing their differentiation into diabetogenic cells. The blockade of IL2rb restores immune tolerance, inhibits insulitis, and diabetes in nonobese diabetic (NOD) mice. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | l2rb |
Uniprot No. | P16297 |
Research Area | Others |
Alternative Names | Il2rbInterleukin-2 receptor subunit beta; IL-2 receptor subunit beta; IL-2R subunit beta; IL-2RB; High affinity IL-2 receptor subunit beta; p70-75; CD antigen CD122 |
Species | Mus musculus (Mouse) |
Source | E.coli |
Expression Region | 24-240aa |
Target Protein Sequence | ASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 29.0kDa |
Protein Length | Extracellular Domain |
Tag Info |
N-terminal 6xHis-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15.
|
Gene References into Functions |
|
Subcellular Location | Cell membrane; Single-pass type I membrane protein. Cell surface. |
Protein Families | Type I cytokine receptor family, Type 4 subfamily |
Database Links |
KEGG: mmu:16185 STRING: 10090.ENSMUSP00000086820 UniGene: Mm.35287 |