Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
S100a8; Mrp8; Protein S100-A8; Calgranulin-A; Migration inhibitory factor-related protein 8; MRP-8; p8; S100 calcium-binding protein A8
Species
Rattus norvegicus (Rat)
Target Protein Sequence
ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Forge ahead in your immunological research with our Recombinant Rat Protein S100-A8, a key player in various cellular processes such as calcium binding and cell migration inhibition. This vital protein, part of the S100 protein family, is known for its profound implications in studies relating to inflammation and disease processes. Bring precision and reliability to your experimentation with our high-quality product.
Synthesized using an E.coli expression system, our Recombinant Rat Protein S100-A8 provides full length coverage of the mature protein, from the 2nd to the 89th amino acid. For your convenience, the protein comes with an N-terminal 6xHis-tag, simplifying its purification and detection process. Through SDS-PAGE analysis, we assure a purity exceeding 90%, underlining our commitment to delivering exceptional quality. Choose the format that best suits your needs, a ready-to-use liquid or a lyophilized powder. Trust in our Recombinant Rat S100-A8 to bolster your research with consistent, high-quality results.
