Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP020641RA |
| Product Type | Recombinant Protein |
| Size |
US$2466Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.) |
| Uniprot No. | P50115 |
| Lead Time | 3-7 business days |
| Relevance | S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chotaxis and adhesion. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and Extracellular domain functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH-oxidase by facilitating the enzyme complex assbly at the cell mbrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assbly by directly binding to NCF2/P67PHOX. The Extracellular domain functions involve proinfammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn2+ which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. The iNOS-S100A8/A9 transnitrosylase complex is proposed to direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as GAPDH, ANXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif; S100A8 ses to contribute to S-nitrosylation site selectivity . |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Calgranulin-AMigration inhibitory factor-related protein 8 ;MRP-8 ;p8S100 calcium-binding protein A8 |
| Species | Rattus norvegicus (Rat) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE |
| Research Area | Others |
| Source | E.coli |
| Gene Names | S100a8 |
| Expression Region | 2-89aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 14.1kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis and adhesion. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include |
| Subcellular Location | Secreted, Cytoplasm, Cytoplasm, cytoskeleton, Cell membrane, Peripheral membrane protein |
| Protein Families | S-100 family |
| Database Links |
KEGG: rno:116547 STRING: 10116.ENSRNOP00000015473 UniGene: Rn.31839 |
| Pathway | IL-17 signaling pathway |
S100a8 Antibodies for Rat
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA020641LA01RA | S100a8 Antibody | Rat | ELISA, WB |
S100a8 Antibodies for Rattus norvegicus (Rat)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA020641LC01RA | S100a8 Antibody, FITC conjugated | Rat | ELISA |
| CSB-PA020641LD01RA | S100a8 Antibody, Biotin conjugated | Rat | ELISA |
| CSB-PA020641LB01RA | S100a8 Antibody, HRP conjugated | Rat | ELISA |
S100a8 Proteins for Rattus norvegicus (Rat)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP20641RA CSB-EP20641RA CSB-BP20641RA CSB-MP20641RA |
Recombinant rat Protein S100-A8 | Yeast E.coli Baculovirus Mammalian cell |
| CSB-YP020641RA | Recombinant Rat Protein S100-A8(S100a8) | Yeast |
| CSB-BP020641RA CSB-MP020641RA |
Recombinant Rat Protein S100-A8(S100a8) | Baculovirus Mammalian cell |
S100a8 ELISA Kit for Rattus norvegicus (Rat)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL020641RA | Rat Protein S100-A8(S100A8) ELISA kit | serum, plasma, tissue homogenates | 0.78 ng/mL |
Recombinant Human Protein phosphatase 1A(PPM1A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Elongation factor Tu, mitochondrial(TUFM)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Mouse Immunoglobulin J chain(Jchain)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Dog Inactive pancreatic lipase-related protein 1(PNLIPRP1)
Express system: Yeast
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Recombinant Mouse Cytotoxic T-lymphocyte protein 4(Ctla4),Partial
Express system: E.coli
Species: Mus musculus (Mouse)
