Recombinant Rat Protein S100-A8(S100a8)

Code CSB-BP020641RA
Size Pls inquire other sizes
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP020641RA-B
Size Pls inquire other sizes
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP020641RA
Size Pls inquire other sizes
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity >85% (SDS-PAGE)
Target Names S100a8
Uniprot No. P50115
Alternative Names S100a8; Mrp8; Protein S100-A8; Calgranulin-A; Migration inhibitory factor-related protein 8; MRP-8; p8; S100 calcium-binding protein A8
Species Rattus norvegicus (Rat)
Expression Region 2-89aa
Target Protein Sequence ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE
Mol. Weight 12.11kD
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Datasheet Please contact us to get it.

Target Data

Function S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis and adhesion. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include
Gene References into Functions
  1. Establish S100A8 transgenic rats to elucidate role as a regulator in acute inflammation. PMID: 28913572
  2. Recombinant rat r-S100A8 bound to r-CD68. The expression levels of S100A8 were significantly suppressed after the macrophages had been treated with an anti-CD68 antibody. Small interfering CD68 also significantly suppressed activation of macrophages through an autocrine pathway by r-S100A8. PMID: 27312849
  3. results support S100A8 as a novel therapeutic target to control ASM contraction in asthma PMID: 28088518
  4. vagus nerve electrical stimulation may produce a protective effect on septic shock in rats by decreasing the production of S100A8. PMID: 27035526
  5. Expression of S100A8 mRNA and the corresponding protein in cultured NRVCs was similar between control cells and norepinephrine-stimulated cells, but was markedly upregulated at 12 hours after the withdrawal of NE. PMID: 25820336
  6. Mrp8 may potentiate the perpetuation of mesial temporal lobe epilepsy by activating the NF-kappaB pathway in astrocytes. PMID: 23982744
  7. Report role for MRP8 for exaggerated in-stent restenosis in diabetes mellitus type 2. PMID: 22381691
  8. In vivo zinc regulates S100A8 expression and modulates the link between S100A8-RAGE interaction and downstream nuclear factor kappaBeta/COX-2 signaling PMID: 19111725
  9. The bladder uroepithelium was a prominent cell source of S100A8-S100A9 in animals with complicated urinary tract infection, which was not detected in animals with asymptomatic urinary tract infection. PMID: 19667050

Show More

Hide All

Subcellular Location Secreted, Cytoplasm, Cytoplasm, cytoskeleton, Cell membrane, Peripheral membrane protein
Protein Families S-100 family
Database Links

KEGG: rno:116547

STRING: 10116.ENSRNOP00000015473

UniGene: Rn.31839

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1