Recombinant Simian immunodeficiency virus Protein Vpx (vpx)

In Stock
Code CSB-EP323941SHD
Abbreviation Recombinant Simian immunodeficiency virus vpx protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP323941SHD could indicate that this peptide derived from E.coli-expressed Simian immunodeficiency virus (isolate PBj14/BCL-3) (SIV-sm) (Simian immunodeficiency virus sooty mangabey monkey) vpx.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP323941SHD could indicate that this peptide derived from E.coli-expressed Simian immunodeficiency virus (isolate PBj14/BCL-3) (SIV-sm) (Simian immunodeficiency virus sooty mangabey monkey) vpx.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
vpx
Uniprot No.
Research Area
Others
Alternative Names
vpxProtein Vpx; Viral protein X; X ORF protein
Species
Simian immunodeficiency virus (isolate PBj14/BCL-3) (SIV-sm) (Simian immunodeficiency virus sooty mangabey monkey)
Source
E.coli
Expression Region
1-112aa
Target Protein Sequence
MSDPRERIPPGNSGEETIGEAFDWLDRTVEEINRAAVNHLPRELIFQVWRRSWEYWHDEMGMSVSYTKYRYLCLIQKAMFMHCKKGCRCLGGEHGAGGWRPGPPPPPPPGLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.9kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I have purchased your vpx recombinant protein a long time ago (CSB-EP323941SHD; Lot#: E051453) and I would like to see the COA for the batch we received. Can you please provide this COA. Also, was the protein sent to us liquid or lyophilized? Please provide the formulation of the buffer that was used as well as Endotoxin level (if tested).

A:
Very nice to receive your inquiry. I have checked your order record and the details are as below.
Name: Recombinant Simian immunodeficiency virus Protein Vpx (vpx)
CUSABIO Code: CSB-EP323941SHD
Order Time: September 5th, 2014
Size: 5mg
Seq Pos: 1-112
Sequence:

MSDPRERIPPGNSGEETIGEAFDWLDRTVEEINRAAVNHLPRELIFQVWRRSWEYWHDEMGMSVSYTKYR YLCLIQKAMFMHCKKGCRCLGGEHGAGGWRPGPPPPPPPGLA


Tag Information: His tagged
Unit Size: 5 mg (E Coli Derived)
This protein was delivered in year 2014. We didn't provide COA at that time and could only provide datasheet (attached).
The formulation of the buffer is 20mM Tris-HCl, 0.5M NaCl, PH 8.0,50% glycerol.
You didn't require endotoxin removal when placing the order, so didn't test the endotoxin level.
Q:

We recently received your protein CSB-EP323941SHD, lot 03767, which was concerned because this lot was more concentrated than the previous lots they received. We want to verify the concentration, and were wondering if you had a recommended commercial assay that we would be able to purchase to confirm the concentration found by your team. Would you be able to advise on the Bradford kit you guys used to determine the concentration of this lot?

A:
Thanks for your inquiry. As shown in our Datasheet&COA, the method we used to determine the protein concentration is Bradford Method, and the standard we used is BSA.
We determined this group of solutions by formulating a set of bovine serum albumin (BSA) solutions at concentrations of 0.10 mg/ml, 0.08 mg/ml, 0.06 mg/ml, 0.04 mg/ml, 0.02 mg/ml, and 0 mg/ml, respectively.
The absorbance gives a standard curve of protein concentration versus absorbance. The absorbance of the sample of unknown protein concentration was determined, and the concentration of the protein was
obtained according to a standard curve. At the same time, we also combined SDS-PAGE observations to determine the target protein concentration.
For your problem "Lot03767 was more concentrated than the previous lots we received". Would you please confirm which lots you had received before?
Q:

Lot# 03767 concentration question. Hello, My Certificate of analysis for this lot says 0.3 mg/ml. This is my third lot that I have received in the past year, and this lot seems to be more potent than the other two lots when run in the same assay. I see that you test concentration by using the Bradford Method. I have two topics that I would like to know more about: 1) Do you have more specific data for this lot--was it closer to 0.34 mg/mL--or does this assay only give results to one significant figure? 2) Do you use a commercial test kit to measure the concentration? I see that Thermal Fisher Life Technologies has several types of test kits made by Pierce available. Do you know if their cat #23236 Coomassie Plus (Bradford) Assay Kit will give similar concentration results as what you perform? Do you have a suggestion of a commercial test kit that I could use to check the protein concentration myself? Thank you for your help with this inquiry.
Current lot→0.3mg/ml
Lot# 03614→0.8mg/ml
Lot# 03433→0.4mg/ml

A:
Thanks for your quick response.
1. Yes. The result gives an approximation that is not a very certain value.
So whether it is close to 0.34 mg/ml, there is such a possibility, but we can't confirm it yet, and there may be some deviations in different concentration detection methods.
2. We did not use a commercial test kit to measure the concentration.
If you want to verify, you can buy a commercial test kit to detect relevant protein concentration, and we will be grateful if you finally share the test results with us.

Target Background

Function
Plays a role in nuclear translocation of the viral pre-integration complex (PIC), thus is required for the virus to infect non-dividing cells. Targets specific host proteins for degradation by the 26S proteasome. Acts by associating with the cellular CUL4A-DDB1 E3 ligase complex through direct interaction with host VPRPB/DCAF-1. This change in the E3 ligase substrate specificity results in the degradation of host SAMHD1. In turn, SAMHD1 depletion allows viral replication in host myeloid cells by preventing SAMHD1-mediated hydrolysis of intracellular dNTPs necessary for reverse transcription.
Subcellular Location
Virion. Host nucleus.
Protein Families
Lentivirus VPX protein family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*