Recombinant Human Vitamin K-dependent gamma-carboxylase(GGCX)

Code CSB-CF009388HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P38435
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence AVSAGSARTSPSSDKVQKDKAELISGPRQDSRIGKLLGFEWTDLSSWRRLVTLLNRPTDPASLAVFRFLFGFLMVLDIPQERGLSSLDRKYLDGLDVCRFPLLDALRPLPLDWMYLVYTIMFLGALGMMLGLCYRISCVLFLLPYWYVFLLDKTSWNNHSYLYGLLAFQLTFMDANHYWSVDGLLNAHRRNAHVPLWNYAVLRGQIFIVYFIAGVKKLDADWVEGYSMEYLSRHWLFSPFKLLLSEELTSLLVVHWGGLLLDLSAGFLLFFDVSRSIGLFFVSYFHCMNSQLFSIGMFSYVMLASSPLFCSPEWPRKLVSYCPRRLQQLLPLKAAPQPSVSCVYKRSRGKSGQKPGLRHQLGAAFTLLYLLEQLFLPYSHFLTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGRTGELGYLNPGVFTQSRRWKDHADMLKQYATCLSRLLPKYNVTEPQIYFDIWVSINDRFQQRIFDPRVDIVQAAWSPFQRTSWVQPLLMDLSPWRAKLQEIKSSLDNHTEVVFIADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVKGGPEPTPLVQTFLRRQQRLQEIERRRNTPFHERFFRFLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGELNPSNTDSSHSNPPESNPDPVHSEF
Source in vitro E.coli expression system
Gene Names GGCX
Protein Names Recommended name: Vitamin K-dependent gamma-carboxylase EC= 4.1.1.90Alternative name(s): Gamma-glutamyl carboxylase Peptidyl-glutamate 4-carboxylase Vitamin K gamma glutamyl carboxylase
Expression Region 2-758
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mediates the vitamin K-dependent carboxylation of glutamate residues to calcium-binding gamma-carboxyglutamate (Gla) residues with the concomitant conversion of the reduced hydroquinone form of vitamin K to vitamin K epoxide.
Involvement in disease Combined deficiency of vitamin K-dependent clotting factors 1 (VKCFD1); Pseudoxanthoma elasticum-like disorder with multiple coagulation factor deficiency (PXEL-MCFD)
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Vitamin K-dependent gamma-carboxylase family
Database Links

HGNC: 4247

OMIM: 137167

KEGG: hsa:2677

STRING: 9606.ENSP00000233838

UniGene: Hs.77719

Q&A and Customer Reviews

Q&A
Q:

I have some questions about Recombinant Human Vitamin K-dependent gamma-carboxylase(GGCX), CSB-CF009388HU.
1.Is this protein has a enzymatiic activity?
2.what is the sequence of E.coli produced VKD GG? Full length was expressed?
3.Do you have any recombinant protein that can be cut by furin?

A:
Thanks for your inquiry.
This is a five times transmembrane protein, we can provide full length protein by cell free expression system, and partial protein with other four regular expression systems.
We don't test activity, so we can't guarantee 100% activity.
We have the recombinant protein that can be cut by furin. Such as: Recombinant Human Tumor necrosis factor ligand superfamily member 13B(TNFSF13B),partial CSB-EP897523HU.
The detailed informatoin will depend on your experiment requirements. Please let us know more.
Customer Reviews

Related Products

GGCX Antibodies

GGCX Antibodies for Homo sapiens (Human)

GGCX Antibodies for Human

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.